KEGG   Mus musculus (mouse): 11438
Entry
11438             CDS       T01002                                 

Gene name
Chrna4, Acra-4, Acra4, EBN1, ENFL1
Definition
(RefSeq) cholinergic receptor, nicotinic, alpha polypeptide 4
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04725  Cholinergic synapse
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11438 (Chrna4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    11438 (Chrna4)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    11438 (Chrna4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    11438 (Chrna4)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   11438 (Chrna4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 11438
NCBI-ProteinID: NP_056545
MGI: 87888
Ensembl: ENSMUSG00000027577
Vega: OTTMUSG00000016395
UniProt: O70174 Q53YK0
Position
2 H4; 2 103.54 cM
AA seq 629 aa
MEIGGSGAPPPLLLLPLLLLLGTGLLPASSHIETRAHAEERLLKRLFSGYNKWSRPVANI
SDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELI
WRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMK
FGSWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFI
IRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPS
TSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFM
KRPSVVKDNCRRLIESMHKMANAPRFWPEPESEPGILGDICNQGLSPAPTFCNRMDTAVE
TQPTCRSPSHKVPDLKTSEVEKASPCPSPGSCHPPNSSGAPVLIKARSLSVQHVPSSQEA
AEGSIRCRSRSIQYCVSQDGAASLTESKPTGSPASLKTRPSQLPVSDQTSPCKCTCKEPS
PVSPITVLKAGGTKAPPQHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVI
DRIFLWMFIIVCLLGTVGLFLPPWLAGMI
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggagatcgggggctccggggcgccgccgccgctgctgctcctgccgctcctgctgctc
ttagggaccggcctcttgcctgctagcagccacatagagacccgggcccatgcggaggag
cggctcctgaagagactcttctctggctacaacaagtggtctcggccagtagccaatatc
tcagatgtggtccttgtccgctttggcttgtcgattgctcagctcattgatgtggatgag
aaaaaccagatgatgacgaccaacgtgtgggtgaagcaggagtggcatgactacaaactg
cgctgggaccctggtgactacgagaatgtcacctccatccgcatcccatctgaactcatc
tggaggcctgacatcgtcctctacaacaacgcggacggggactttgcagtcacccaccta
accaaagcccacctgttctatgatgggcgtgtgcagtggacacccccggccatctataag
agctcctgcagcatcgacgtcaccttcttccccttcgaccagcagaactgtaccatgaag
tttgggtcctggacctacgacaaggccaagattgacttggtgagcatgcacagccgtgtg
gaccaactggacttctgggaaagtggggagtgggtcattgtggatgccgtgggcacctac
aacaccaggaagtatgaatgctgtgccgagatctatcctgacatcacctacgccttcatc
atccgccgactgccactgttctacaccatcaaccttatcatcccgtgcctgctcatctcc
tgcctcaccgtgctggtcttctatctgccctcggagtgcggcgagaaggtcacgctgtgc
atctcggtgctgctttctctcaccgtcttcctgctgctcatcaccgagatcatcccgtcc
acctcgctggtcatcccgctcatcggcgagtacctgctcttcaccatgatcttcgtcacc
ctctccattgtcatcacggtcttcgtgctcaatgtacaccaccgctcaccacgcacacac
accatgcccgcctgggtgcgcagagtcttcctggacattgtgccccgtctcctcttcatg
aagcgcccatctgtggtcaaagacaactgccggagacttatcgaatccatgcacaagatg
gccaacgcccctcgtttctggccagagcctgagagtgagcccggcatcttgggtgacatc
tgcaaccaaggcctgtcacctgccccaactttctgcaaccgcatggacacagcagtcgag
acccagcctacatgcaggtcaccctcccacaaggtccctgacttgaagacatcagaggtt
gagaaggccagtccctgtccatcacctggctcttgtcacccacccaatagcagtggggcc
ccagtgctcatcaaagccaggtccctgagcgtccagcatgtgcccagctcccaggaagca
gccgagggcagcatccgctgccggtctcggagtatccagtactgtgtttcccaagatgga
gctgcttccctgactgagagcaagcccactggctccccagcctccctgaagacccgtcca
tcccagcttccagtgtcagaccagacctctccatgcaaatgcacatgcaaggaaccatct
cctgtgtcccccatcactgtgctcaaggctggaggcaccaaagcacctccccaacacctg
cccctgtcaccagccctgacacgggcagtagaaggcgtccagtacattgcagaccacctc
aaggcagaagacacagacttctcggtgaaggaggactggaaatacgtggccatggtcatt
gaccgaatcttcctctggatgttcatcattgtctgccttctgggcactgtgggactcttc
ctgcctccatggttggctggtatgatctag

DBGET integrated database retrieval system