KEGG   Mus musculus (mouse): 11440
Entry
11440             CDS       T01002                                 

Symbol
Chrna6, Acra6, Nica6
Name
(RefSeq) cholinergic receptor, nicotinic, alpha polypeptide 6
  KO
K04808  nicotinic acetylcholine receptor alpha-6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04725  Cholinergic synapse
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11440 (Chrna6)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    11440 (Chrna6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    11440 (Chrna6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    11440 (Chrna6)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   11440 (Chrna6)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD gpUL132
Other DBs
NCBI-GeneID: 11440
NCBI-ProteinID: NP_067344
MGI: 106213
Ensembl: ENSMUSG00000031491
Vega: OTTMUSG00000061079
UniProt: Q9R0W9
Position
8:complement(27893240..27903972)
AA seq 494 aa
MLNSRDQGNLHSGLCLWLCGFLALFKGSTGCESEEQLFHRLFAHYNRFIRPVENVSDPVT
VHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDI
VLYNNAVGDFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
MFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVI
PLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTIFLQAFPSILMMRKPLD
KTKEAGGVKDPKSHTKRPAKVKFTHRGESKLLKECHHCQKSSDIAPGKRRSSQQPARWVA
ENSEHSSDVEDVIESVQFIAENMKSHNETNEVEDDWKYMAMVVDRVFLWVFIIVCVFGTV
GLFLQPLLGNTGKS
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgctgaacagccgggaccagggaaacctgcactccggtttatgtctgtggctatgtgga
ttcctggctctctttaaaggcagtacaggctgtgaatctgaagagcagctcttccacagg
ctgtttgctcactacaaccgcttcatccggccggtggagaatgtctccgatcccgtcacg
gtgcattttgaattggcaatcacgcaactggccaatgtggatgaagtcaaccagattatg
gagaccaatctgtggctgcgtcacatctggaaggactacagattgcgttgggatccaacg
gagtatgatggcatcgagacacttcgagttccagcagacaacatctggaagcctgacatc
gttctgtataacaatgctgtcggcgacttccaggtcgaaggcaagaccaaagctcttctc
aagtatgacggtgtgataacctggaccccaccagccatctttaagagctcctgcccaatg
gacatcaccttcttcccgtttgaccatcaaaactgctccctgaagtttggttcctggact
tatgacaaggcagaaatcgaccttctcatcattggctctaaagtagacatgaacgacttt
tgggaaaacagtgaatgggaaattgtcgacgcctctggctataagcatgacatcaagtac
aactgctgtgaagagatttacacggacataacctactccttctacatcaggaggttgccc
atgttttacaccatcaacctcatcatcccctgcctcttcatttccttcctcacggtgctg
gttttttaccttccctccgactgtggcgagaaagtgactctttgcatctccgttctgctt
tctctcactgtctttttgctggtgattacagagaccatcccatccacatctctcgtgatc
ccactggtgggtgagtatctactgttcaccatgatctttgtcacgctgtccattgtggtg
accgtgttcgtgctgaacatacactacaggaccccagcaacgcataccatgcccaagtgg
gtgaagaccatcttccttcaggccttcccctcgattctgatgatgaggaaacctctggac
aagacaaaggaggcaggaggtgttaaggaccccaaaagccataccaagaggcctgccaag
gtcaaatttactcatcgaggagaatccaaacttctaaaggaatgccaccactgccaaaaa
tcaagtgacatagcacctggaaagagaagatcaagccagcagcctgcacggtgggtggca
gagaattcagagcactcgtccgatgttgaagatgtcatcgagagtgttcaattcatagca
gaaaacatgaagagccacaatgaaacaaacgaggtagaagacgactggaaatacatggct
atggtggtggacagagtcttcctttgggtatttataattgtctgtgtgtttggaactgtg
gggctatttctgcagccactgcttgggaacacaggaaagtcttaa

DBGET integrated database retrieval system