KEGG   Mus musculus (mouse): 11441
Entry
11441             CDS       T01002                                 

Gene name
Chrna7, Ac, Acra7, al, alpha7, nAchR
Definition
(RefSeq) cholinergic receptor, nicotinic, alpha polypeptide 7
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04725  Cholinergic synapse
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05033  Nicotine addiction
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    11441 (Chrna7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11441 (Chrna7)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    11441 (Chrna7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    11441 (Chrna7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11441 (Chrna7)
   05022 Pathways of neurodegeneration - multiple diseases
    11441 (Chrna7)
  09165 Substance dependence
   05033 Nicotine addiction
    11441 (Chrna7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    11441 (Chrna7)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   11441 (Chrna7)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb SUR7
Other DBs
NCBI-GeneID: 11441
NCBI-ProteinID: NP_031416
MGI: 99779
Ensembl: ENSMUSG00000030525
Vega: OTTMUSG00000059577
UniProt: P49582 Q53YJ9 Q8CC01
Position
7 C; 7 34.47 cM
AA seq 502 aa
MCGRRGGIWLALAAALLHVSLQGEFQRRLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDL
QMQEADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCAWFLRMKRPGEDKVRPACQHK
PRRCSLASVELSAGAGPPTSNGNLLYIGFRGLEGMHCAPTPDSGVVCGRLACSPTHDEHL
MHGTHPSDGDPDLAKILEEVRYIANRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgtgcggccggcggggaggcatctggctggctctggccgcggcgctgctgcacgtgtcc
ctgcaaggcgagttccagaggaggctgtacaaggagctggtcaagaactacaacccgctg
gagaggccggtggccaacgactcgcagccgctcaccgtgtacttctccctgagcctcctg
cagatcatggatgtggatgagaagaaccaagttttaaccaccaacatttggctacaaatg
tcttggacagatcactatttgcagtggaacatgtctgagtaccccggagtgaaaaatgtt
cgttttccagatggccagatttggaaaccagacattctcctctataacagtgcagatgaa
cgctttgatgccacattccacaccaacgtcttggtgaatgcatctgggcattgccagtat
ctccctccaggcatattcaagagctcctgctacatcgatgtacgctggttcccttttgat
gtgcagcagtgcaaactgaagtttgggtcctggtcctatggagggtggtccttggacctg
cagatgcaagaggcagatatcagcagctatatccccaatggagaatgggatctcatggga
atccctggcaaaaggaatgagaagttctatgaatgctgcaaagagccatacccagatgtc
acctacacagtaaccatgcgccgtaggacactctactatggcctcaacctgctcattcct
tgtgtgctcatttcagccctggctttgctggtattcttgctgcctgcagactctggagag
aaaatctctcttggaataactgtcttactttctctgactgtcttcatgctgcttgtggct
gagatcatgccagcaacatctgattccgtgcccttgatagcacagtacttcgccagcacc
atgatcatcgtgggcctctcagtggtcgtgacagtgattgtgctgcgatatcaccaccat
gaccctgatggtggcaaaatgcctaagtggaccaggatcattcttctgaattggtgtgca
tggtttctgcgcatgaagaggccgggagaggacaaggtgcggccggcttgtcagcacaag
cctcggcgctgcagcctggccagtgtggagctgagcgcaggtgcggggccacccaccagc
aatggcaacctgctctacattggcttccgaggcctggagggcatgcactgtgccccaact
ccagactctggggtcgtgtgtggtcgtttggcctgctccccaacacatgatgagcacctc
atgcatggtacacacccctctgatggggaccccgacctggccaagatcctggaggaggtc
cgctacatcgccaaccgcttccgctgccaggatgagagtgaggtgatctgcagtgagtgg
aagtttgcggcctgtgtggtggaccgcttgtgcctcatggccttttcggtttttaccatc
atctgcaccatcggcatcctcatgtcagccccaaactttgtggaggctgtgtccaaagac
tttgcttaa

DBGET integrated database retrieval system