KEGG   Mus musculus (mouse): 11443
Entry
11443             CDS       T01002                                 

Symbol
Chrnb1, Ac, Achr, Achr-2, Acrb
Name
(RefSeq) cholinergic receptor, nicotinic, beta polypeptide 1 (muscle)
  KO
K04812  nicotinic acetylcholine receptor beta-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11443 (Chrnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    11443 (Chrnb1)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   11443 (Chrnb1)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 11443
NCBI-ProteinID: NP_033731
MGI: 87890
Ensembl: ENSMUSG00000041189
Vega: OTTMUSG00000005993
UniProt: P09690
Position
11 B3; 11 42.87 cM
AA seq 501 aa
MALGALLLLLGVLGTPLAPGARGSEAEGQLIKKLFSNYDSSVRPAREVGDRVGVSIGLTL
AQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNND
GNFDVALDINVVVSFEGSVRWQPPGLYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVS
LKTGLDPEGEERQEVYIHEGTFIENGQWEIIHKPSRLIQLPGDQRGGKEGHHEEVIFYLI
IRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPE
TSLAVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPFWVRQIFIHKLPPYLGL
KRPKPERDQLPEPHHSLSPRSGWGRGTDEYFIRKPPSDFLFPKLNRFQPESSAPDLRRFI
DGPTRAVGLPQELREVISSISYMARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIVFTS
VGTLVIFLDATYHLPPPEPFP
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggccttaggggcgctgcttctgcttctaggggtactcgggacgcccctcgccccaggc
gcccgcgggtcggaagccgaaggccaactgattaagaaacttttctccaactatgatagc
tcggtgaggccggcgcgggaggtgggagaccgcgtcggggtcagcatcggcctcaccctg
gcgcaactcatcagcctgaacgagaaggatgaagaaatgagcacaaaggtgtacttagac
ctggagtggaccgactacaggttaagctgggaccccgcagaacatgatggcatcgattct
ctccgcatcactgctgaatccgtttggctccctgatgtggtgctgctgaacaacaatgac
ggaaatttcgacgttgccctggacatcaatgttgtggtatctttcgagggctctgtgcgc
tggcaaccccctggcctgtaccgcagcagctgcagcatccaggtcacctacttccccttt
gactggcagaactgcaccatggtgtttagttcctacagctatgacagctctgaggtcagc
ctgaagacgggcctggatcctgaaggagaggagaggcaggaagtctacattcatgaaggg
accttcattgagaatggccaatgggagattatccacaaaccttctaggttaatccaactt
ccaggggatcagagaggtgggaaggaagggcatcatgaggaagttatcttctatctcatt
attcggcggaagcctctcttctacctggtcaacgtcattgccccatgcatcctcatcacg
ctcctggccatctttgtcttctacctcccaccagatgcaggagagaagatggggctctcc
atctttgccctgctgacgctcactgtgttcttgctgctgttggccgacaaagtgcctgag
acctccctggcggtgcccatcattatcaagtacctcatgtttaccatggtccttgtcacc
ttctccgttatccttagtgttgtggtcctcaacctgcatcatcgctcaccccacacccac
caaatgcccttttgggtccgccagatcttcattcacaagctccctccatacctgggtctg
aagaggcccaaacccgagagagaccaactccctgaaccacatcactctctttctccaaga
agtggctggggcagaggaactgatgaatatttcatccggaagcctccaagtgattttctt
ttccctaaacttaacaggtttcagcctgaatcatctgccccggacctgcgacgatttatc
gatggtccaacccgggctgtaggtctgcctcaggagctacgagaggtcatttcctcaatc
agctacatggcccgacagcttcaggaacaggaggaccacgacgcactgaaggaggactgg
cagtttgtggccatggttgtggaccgtctttttctgtggacattcatcgttttcacaagc
gtcgggaccctagtcattttcctagatgccacgtaccatttgccccctcctgaacctttc
ccttga

DBGET integrated database retrieval system