KEGG   Mus musculus (mouse): 11444
Entry
11444             CDS       T01002                                 

Gene name
Chrnb2, Acrb-2, Acrb2, C030030P04Rik, [b]2-nAchR
Definition
(RefSeq) cholinergic receptor, nicotinic, beta polypeptide 2 (neuronal)
  KO
K04813  nicotinic acetylcholine receptor beta-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04725  Cholinergic synapse
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11444 (Chrnb2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    11444 (Chrnb2)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    11444 (Chrnb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    11444 (Chrnb2)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   11444 (Chrnb2)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 11444
NCBI-ProteinID: NP_033732
MGI: 87891
Ensembl: ENSMUSG00000027950
Vega: OTTMUSG00000052879
UniProt: Q9ERK7
Position
3 F1; 3 39.19 cM
AA seq 501 aa
MARCSNSMALLFSFGLLWLCSGVLGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLY
NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR
TEIDLVLKSDVASLDDFTPSGEWDIIALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPTLLFLQQPRHRCARQR
LRLRRRQREREGAGTLFFREGPAADPCTCFVNPASMQGLAGAFQAEPAAAGLGRSMGPCS
CGLREAVDGVRFIADHMRSEDDDQSVREDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQP
LFQNYTATTFLHSDHSAPSSK
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggcccggtgctccaactctatggcgctgctgttcagctttggcctcctttggctgtgt
tcaggggttttgggtactgacacagaggagcggctggtggagcatctcttggatccttcc
cgctataacaagctgatccgtccagctactaatggctctgagctggtgactgtacagctc
atggtatcattggcacagctcatcagtgtgcacgagcgggagcagatcatgaccaccaac
gtctggctgacccaggagtgggaagattatcgcctcacatggaagcctgaggatttcgac
aatatgaagaaagtccgactcccttctaagcacatctggctcccagatgtggttctatac
aacaatgctgacggcatgtacgaagtctccttctattccaatgctgtggtctcctatgat
ggcagcatcttttggctaccgcctgccatctacaagagcgcatgcaagattgaggtgaag
cacttcccatttgaccagcagaactgcaccatgaagttccgctcctggacctacgaccgc
actgagattgacctggtgctcaaaagcgatgtggccagcctggacgacttcacacctagt
ggggagtgggacatcatcgcactgccaggccgacgcaacgagaacccagacgactccacc
tacgtggacatcacctacgacttcatcattcgtcgcaaaccgctcttctacaccatcaac
ctcatcatcccctgcgtactcatcacctcgctggccatcctggtcttctacctgccctca
gactgtggtgaaaagatgacactttgtatttctgtgctgctggcgctcacggtgttcctg
ctgctcatctccaagattgtgcctcccacctccctcgacgtaccgctggtgggaaagtac
ctcatgttcaccatggtgctagtcaccttctccatcgtcactagcgtgtgtgtgctcaat
gtgcaccaccgttcgcctaccacgcacaccatggcgccctgggtcaaggtggtcttcctg
gagaagctgcccaccctcctcttcctgcagcagccacgccaccgctgtgcacgtcaacgc
ctgcgcttgcgaaggcgccagcgggaacgtgagggggcaggcacactattcttccgcgaa
ggtcctgcagctgacccatgtacctgctttgtcaatcctgcatcaatgcagggcttggct
ggggctttccaggctgagcccgctgcagccggtctggggcgctcgatgggcccatgcagc
tgtggcctccgggaagctgtggacggtgtacgcttcattgcggaccatatgcgaagtgaa
gatgatgaccagagtgtgagggaggattggaaatacgttgccatggtgatcgaccgcctg
ttcctctggatctttgtctttgtctgtgtctttgggaccattggcatgttcctgcagcct
ctcttccagaactacactgccacgaccttccttcactctgaccactcagctcccagctcc
aagtga

DBGET integrated database retrieval system