KEGG   Mus musculus (mouse): 11447
Entry
11447             CDS       T01002                                 

Gene name
Chrnd, Achr-4, Acrd, L10076
Definition
(RefSeq) cholinergic receptor, nicotinic, delta polypeptide
  KO
K04816  nicotinic acetylcholine receptor delta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11447 (Chrnd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    11447 (Chrnd)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   11447 (Chrnd)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD Levi_coat
Other DBs
NCBI-GeneID: 11447
NCBI-ProteinID: NP_067611
MGI: 87893
Ensembl: ENSMUSG00000026251
Vega: OTTMUSG00000048192
UniProt: P02716 Q80VZ5
Position
1 C5; 1 44.07 cM
AA seq 520 aa
MAGPVLTLGLLAALVVCALPGSWGLNEEQRLIQHLFNEKGYDKDLRPVARKEDKVDVALS
LTLSNLISLKEVEETLTTNVWIDHAWVDSRLQWDANDFGNITVLRLPPDMVWLPEIVLEN
NNDGSFQISYACNVLVYDSGYVTWLPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAK
EITLSLKQEEENNRSYPIEWIIIDPEGFTENGEWEIVHRAAKLNVDPSVPMDSTNHQDVT
FYLIIRRKPLFYIINILVPCVLISFMINLVFYLPGDCGEKTSVAISVLLAQSVFLLLISK
RLPATSMAIPLVGKFLLFGMVLVTMVVVICVIVLNIHFRTPSTHVLSEGVKKFFLETLPK
LLHMSRPAEEDPGPRALIRRSSSLGYICKAEEYFSLKSRSDLMFEKQSERHGLARRLTTA
RRPPASSEQVQQELFNEMKPAVDGANFIVNHMRDQNSYNEEKDNWNQVARTVDRLCLFVV
TPVMVVGTAWIFLQGVYNQPPLQPFPGDPFSYSEQDKRFI
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggcagggcctgtgctcacactggggctgctggctgcccttgttgtgtgtgccctccca
ggcagttggggcctgaatgaggaacaaaggctgatccagcacctattcaatgagaagggc
tacgacaaagacctgcggccggtggctcgaaaggaggacaaagtggatgtcgccctaagt
ctcaccctctccaacctcatctccctgaaagaagtggaggagaccctcaccaccaacgtg
tggatagatcatgcctgggtagacagccgtctacagtgggatgccaacgacttcgggaac
atcactgtcctgcgcctgccccctgacatggtgtggctaccagagattgtactggagaac
aacaatgatggctcgttccagatttcttatgcctgcaatgtgcttgtctatgactcgggc
tatgtgacctggctgccgcccgccatcttccgctcctcctgccccatctcagtcacctac
ttccctttcgactggcagaactgctccctcaaattcagttcactcaagtatacagccaag
gagatcacacttagcctgaagcaggaggaggaaaacaaccgctcttaccccatcgagtgg
atcatcattgaccctgaaggtttcacagagaacggtgagtgggagatagtgcatcgggca
gccaagctcaatgtggaccccagtgtcccgatggacagcaccaaccaccaagatgtcacc
ttctaccttatcatccgccgcaagcccctcttctacatcatcaacattctggtaccctgc
gtgctcatctccttcatgatcaacctagtcttctacctgccaggcgactgtggagagaag
acctccgtggccatctcagtgctcctggcccaatctgtcttcctgctgcttatctccaag
aggctgccggccacttccatggccatccccttggtaggcaagttcctgcttttcggcatg
gtgctggtcaccatggtggtggtgatctgtgtcatcgtactgaacatccacttccggacg
cccagcacccatgtgctgtctgagggagtcaagaagttcttcctggagaccctgcccaag
ctcctgcacatgtcccgcccagcagaggaagacccaggccccagggctctcatccggaga
agcagctctctgggatacatctgcaaagcagaggagtatttctcacttaagtcccgcagt
gacctcatgtttgagaagcaatcagagcggcatgggctggcccggcgcctcaccacagcc
cgcaggcctccagcaagctctgagcaggtccaacaggagctcttcaatgagatgaagcca
gctgtggatggggcaaacttcatcgtcaaccatatgagagaccaaaacagttacaatgag
gagaaggacaactggaaccaggtggcccgcacagtggaccgtctctgcctgtttgtggtg
acacccgtcatggtggtgggcacagcctggatcttcctgcagggtgtctacaaccagccc
ccactccagcctttccctggggaccccttctcctatagcgaacaggacaagcgcttcatc
tag

DBGET integrated database retrieval system