KEGG   Mus musculus (mouse): 11448
Entry
11448             CDS       T01002                                 

Gene name
Chrne, AChrepsilon, Acre, nAChRE
Definition
(RefSeq) cholinergic receptor, nicotinic, epsilon polypeptide
  KO
K04817  nicotinic acetylcholine receptor epsilon
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11448 (Chrne)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    11448 (Chrne)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   11448 (Chrne)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 11448
NCBI-ProteinID: NP_033733
MGI: 87894
Ensembl: ENSMUSG00000014609
Vega: OTTMUSG00000006059
UniProt: P20782
Position
11 B3; 11 43.14 cM
AA seq 493 aa
MAGALLGALLLLTLFGRSQGKNEELSLYHHLFDNYDPECRPVRRPEDTVTITLKVTLTNL
ISLNEKEETLTTSVWIGIDWHDYRLNYSKDDFAGVGILRVPSEHVWLPEIVLENNIDGQF
GVAYDSNVLVYEGGYVSWLPPAIYRSTCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFIF
AVDDDGNTINKIDIDTAAFTENGEWAIDYCPGMIRRYEGGSTEGPGETDVIYTLIIRRKP
LFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLS
VPLLGRYLIFVMVVATLIVMNCVIVLNVSLRTPTTHATSPRLRQILLELLPRLLGSSPPP
EDPRTASPARRASSVGILLRAEELILKKPRSELVFEGQRHRHGTWTAALCQNLGAAAPEI
RCCVDAVNFVAESTRDQEATGEELSDWVRMGKALDNVCFWAALVLFSVGSTLIFLGGYFN
QVPDLPYPPCIQP
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggcaggggctctgcttggtgccctgcttctcctgacactctttggcagaagccaggga
aagaatgaagagcttagcctgtatcaccatctcttcgacaattatgatccagaatgccgg
ccagttaggagacctgaggacactgtcaccatcaccctcaaggtcaccctaaccaacctc
atctcactgaacgagaaagaagaaactctgaccaccagtgtctggattggcattgactgg
cacgactatcggctcaactacagcaaggacgattttgcaggtgtaggaatcctccgggtc
ccttcagaacatgtatggctgccagagattgttctagaaaacaatattgatgggcagttt
ggagtggcctacgacagcaatgttctagtctatgagggaggctatgtgagctggttgccc
ccagccatctaccgcagcacctgcgcagtggaggtcacctatttcccctttgactggcag
aactgctctctcatttttcgctcccagacctacaatgctgaggaggtggagttcatcttt
gccgtggatgacgacggcaataccatcaacaagattgacattgacacggcagcttttacc
gagaatggagaatgggccatagactactgcccaggcatgattcgccgctatgagggaggt
tccacagaaggtcctggagaaactgacgtcatctatacgctcatcatccgccggaagccg
cttttttacgtcattaacatcattgtgccttgcgtgctcatttctggcttggtgctgctc
gcttacttcctgcctgcgcaggctggtggccagaaatgcacggtctctatcaacgtcctg
ctagcccagactgtcttcttgtttctaattgcccagaaaattccagagacttctctgagc
gtgccactgctgggcaggtatcttatattcgtcatggtggttgccacgctcattgtcatg
aattgcgtcatcgtgctcaacgtatctttgaggacgccaacgactcatgctacatcccct
cggctgcgccagattttattagagctgctgccgcgtctcctgggctcgagcccaccccca
gaggatccccgaactgcctcaccagcgaggcgtgcctcgtctgtgggcattctgctcaga
gcggaggagctcatcttgaaaaagccgcggagcgaactcgtgtttgagggtcagaggcat
cggcacggaacttggaccgcagccctctgccagaacctgggtgctgcagccccagaaatc
cgctgctgtgtggatgctgtgaactttgtggctgagagcacaagagaccaggaagccact
ggagaggaactgtccgactgggtgcgtatggggaaggccctggacaatgtctgtttttgg
gcagctttggtgctcttcagcgttggttctactctcatcttccttgggggttacttcaac
caagttcctgatctcccttacccaccgtgcatccaaccatga

DBGET integrated database retrieval system