KEGG   Mus musculus (mouse): 11449Help
Entry
11449             CDS       T01002                                 

Gene name
Chrng, Achr-3, Acrg
Definition
(RefSeq) cholinergic receptor, nicotinic, gamma polypeptide
  KO
K04818  nicotinic acetylcholine receptor gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11449 (Chrng)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   11449 (Chrng)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 11449
NCBI-ProteinID: NP_033734
MGI: 87895
Ensembl: ENSMUSG00000026253
Vega: OTTMUSG00000048193
UniProt: F8VQK4
Position
1 C5; 1 44.07 cM
AA seq 519 aa AA seqDB search
MQGGQRPQLLLLLLAVCLGAQSRNQEERLLADLMRNYDPHLRPAERDSDVVNVSLKLTLT
NLISLNEREEALTTNVWIEMQWCDYRLRWDPKDYEGLWILRVPSTMVWRPDIVLENNVDG
VFEVALYCNVLVSPDGCIYWLPPAIFRSSCSISVTYFPFDWQNCSLVFQSQTYSTSEINL
QLSQEDGQAIEWIFIDPEAFTENGEWAIRHRPAKMLLDSVAPAEEAGHQKVVFYLLIQRK
PLFYVINIIAPCVLISSVAILIYFLPAKAGGQKCTVATNVLLAQTVFLFLVAKKVPETSQ
AVPLISKYLTFLMVVTILIVVNSVVVLNVSLRSPHTHSMARGVRKVFLRLLPQLLRMHVR
PLAPAAVQDARFRLQNGSSSGWPIMAREEGDLCLPRSELLFRQRQRNGLVQAVLEKLENG
PEVRQSQEFCGSLKQASPAIQACVDACNLMARARRQQSHFDSGNEEWLLVGRVLDRVCFL
AMLSLFICGTAGIFLMAHYNQVPDLPFPGDPRPYLPLPD
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcaagggggccagagacctcagctcctcttgctgctgttggctgtctgcctgggggcc
cagagccgcaaccaagaggagcgtctgcttgcggacctgatgcgaaactacgacccccac
ctgcggccggctgagcgcgactcagatgtggtcaatgtcagcctgaagcttaccttgacc
aacctcatctccctgaatgaacgagaggaggccctcacaactaacgtctggatagagatg
caatggtgcgactatcgcctgcgctgggacccaaaagactacgaaggcctgtggatattg
agggtgccatctactatggtctggcggccagatatcgtcctggagaacaatgtggacggt
gtcttcgaggtggctctctactgcaatgtcctcgtgtcccccgacggttgtatctactgg
ctgccgcctgccatcttccgctcctcctgctccatctctgtcacctacttccccttcgat
tggcagaactgttccctcgtcttccaatcccagacttacagcaccagtgagatcaacttg
cagctgagccaggaggatgggcaagccattgagtggatcttcattgacccggaggctttc
acagagaatggggagtgggccatccggcaccgaccggctaaaatgctcctggactccgtg
gctcctgcagaggaggcgggccaccagaaggtggtgttctacctgcttatccagcgcaag
cccctcttctacgtcatcaacatcatcgccccctgtgtgctcatctcctcagtcgccatc
ctcatctacttccttcctgctaaggcgggcgggcagaaatgcacagtggccaccaacgtg
ctcctggcccagactgtcttccttttccttgtggctaagaaggtgcctgagacctcccag
gcagtgccactcatcagcaagtacctgaccttcctcatggtggtgaccatcctcatcgtc
gtgaactctgtggtcgtgctcaatgtgtccttgcggtccccccacacacactccatggcc
cgtggggtccgcaaggtgttcctgaggctcctgccccagctgttacggatgcatgtgcgc
ccactagctccagctgctgtccaggatgcccggttccgactccagaatggctcttcctca
gggtggcccatcatggctcgagaggaaggggacctctgtctgcctcgaagcgaactcctc
tttaggcaaaggcagcgcaatggattagtgcaggcagtattggagaagctagagaatggt
ccagaagtgaggcagagccaggagttctgtggcagcctgaagcaagcctccccagccatc
caggcctgtgtggatgcctgtaacctcatggctcgtgcccgacgccagcagagtcacttt
gacagtgggaacgaggagtggttgctggtgggccgagtgctggaccgagtctgcttccta
gccatgctctccctcttcatctgtggcactgctggcatcttcctcatggcccactacaac
caagtgcctgacctgccgttccccggagacccccgcccctacctgcctttgccagactga

DBGET integrated database retrieval system