KEGG   Mus musculus (mouse): 11450Help
Entry
11450             CDS       T01002                                 

Gene name
Adipoq, 30kDa, APN, Acdc, Acrp30, Ad, GBP28, adipo, apM1
Definition
(RefSeq) adiponectin, C1Q and collagen domain containing
  KO
K07296  adiponectin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04920  Adipocytokine signaling pathway
mmu04930  Type II diabetes mellitus
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    11450 (Adipoq)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    11450 (Adipoq)
   03320 PPAR signaling pathway
    11450 (Adipoq)
  09149 Aging
   04211 Longevity regulating pathway
    11450 (Adipoq)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    11450 (Adipoq)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    11450 (Adipoq)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1q Collagen BclA_C
Motif
Other DBs
NCBI-GeneID: 11450
NCBI-ProteinID: NP_033735
MGI: 106675
Ensembl: ENSMUSG00000022878
Vega: OTTMUSG00000035780
UniProt: Q60994
Structure
PDB: 

Position
16 B1; 16 13.96 cM
AA seq 247 aa AA seqDB search
MLLLQALLFLLILPSHAEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDG
RDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSV
GLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFK
KDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGF
LLYHDTN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgctactgttgcaagctctcctgttcctcttaatcctgcccagtcatgccgaagatgac
gttactacaactgaagagctagctcctgctttggtccctccacccaagggaacttgtgca
ggttggatggcaggcatcccaggacatcctggccacaatggcacaccaggccgtgatggc
agagatggcactcctggagagaagggagagaaaggagatgcaggtcttcttggtcctaag
ggtgagacaggagatgttggaatgacaggagctgaagggccacggggcttccccggaacc
cctggcaggaaaggagagcctggagaagccgcttatgtgtatcgctcagcgttcagtgtg
gggctggagacccgcgtcactgttcccaatgtacccattcgctttactaagatcttctac
aaccaacagaatcattatgacggcagcactggcaagttctactgcaacattccgggactc
tactacttctcttaccacatcacggtgtacatgaaagatgtgaaggtgagcctcttcaag
aaggacaaggccgttctcttcacctacgaccagtatcaggaaaagaatgtggaccaggcc
tctggctctgtgctcctccatctggaggtgggagaccaagtctggctccaggtgtatggg
gatggggaccacaatggactctatgcagataacgtcaacgactctacatttactggcttt
cttctctaccatgataccaactga

DBGET integrated database retrieval system