KEGG   Mus musculus (house mouse): 114566
Entry
114566            CDS       T01002                                 
Symbol
Krt82, Krt2-20
Name
(RefSeq) keratin 82
  KO
K07605  type II keratin, basic
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    114566 (Krt82)
   04147 Exosome [BR:mmu04147]
    114566 (Krt82)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     114566 (Krt82)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   114566 (Krt82)
  Exosomal proteins of other body fluids (saliva and urine)
   114566 (Krt82)
  Exosomal proteins of colorectal cancer cells
   114566 (Krt82)
  Exosomal proteins of bladder cancer cells
   114566 (Krt82)
SSDB
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2
Other DBs
NCBI-GeneID: 114566
NCBI-ProteinID: NP_444479
MGI: 2149248
Ensembl: ENSMUSG00000049548
UniProt: Q99M74
Position
15:complement(101449651..101459094)
AA seq 516 aa
MSCRNFQLSPRCGNRSFSSCSAIMPRMVTHYEVSKAPCRSGGGGGLRALGCLGSRSLCNV
GFGRPRVASRCGMPGFGYRAGATCGSSACITPVTINESLLVPLELEIDPTVQRVKRDEKE
QIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRSCQSNMEPLFEGYICALRRQLDC
VSGDHGRLEAELCSLQEALEGYKKKYEEELSLRPCAENEFVTLKKDVDTAFLVKADLETN
LEALEHEIEFLKALFEEEIGLLQSQISETSVIVKMDNSRELDVDGIVAEIKAQYDDIASR
SKAEAEAWYQCRYEELRLTAGNHCDNLRNRKNEILEMNKLIQRLQQDIEAVKGQRCKLEG
AIAQAEQQGEAALTDAKCKLAGLEEALQKAKQDMACLLKQYQEVMNCKLGLDIEIATYRR
LLEGEEHRLCEGIGPVNISVSSSKGAVLYEPCVMGTPMLRTEYCTGTTGVLRNSGGCNVV
GTGELYIPCEPQGLLGCGNGRSSSMKVGVGSNSCSR
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgtcatgccgaaatttccagttgagccccagatgtggcaaccggagtttcagctcgtgc
tcagccatcatgccccggatggtcacccactatgaagtgagcaaggcgccctgtcggtcc
gggggtggcgggggcctccgagccctgggttgccttggctctcggagcctgtgcaacgtg
ggtttcgggaggccccgtgtggcctccagatgcggcatgccaggcttcgggtaccgagcg
ggagccacctgtggatcttctgcctgcatcacccctgtcaccatcaatgagagtctgctg
gtccccctggagctggagattgacccgaccgtgcaaagggtgaagagagatgaaaaggag
cagattaagtgcctgaataaccgattcgcatccttcatcaacaaggtgcggttcctggag
cagaaaaacaagcttctggagaccaagtggaacttcatgcagcagcagagaagttgccag
agcaacatggagccgctcttcgagggctacatctgtgccctgcggcgacagctggactgt
gtgtccggggaccacggcagactagaggccgagctctgcagtctccaggaggcgctggag
ggttataagaaaaagtacgaagaggagctgtctctgcgtccctgtgctgagaatgagttt
gtcaccctgaagaaggacgtggacacagccttcctggtgaaggctgacctggaaaccaac
ttggaggctctagaacatgagattgagttcctgaaagccctgtttgaggaggagatcggc
ctgctgcagtctcagatctcagagacttcagtcatcgtgaagatggacaacagccgggaa
ctggatgtggacggcatcgtagccgagatcaaggcccagtatgacgacatcgccagccgc
agcaaagcagaagcagaggcctggtaccagtgccggtatgaggagctgaggttaacggct
gggaaccactgtgacaacctacgcaaccgcaaaaatgagatcctggaaatgaacaagcta
atccagcggctgcagcaggacattgaggcagtcaaaggccagcgatgcaagctcgagggg
gccattgcccaggcagagcagcagggagaggccgccctcactgatgccaagtgcaagctg
gcagggctggaggaggccttgcagaaggccaagcaggacatggcctgcctgctcaagcag
taccaagaggtgatgaactgcaagctggggctggacatcgagatcgccacctacaggcgc
ctgctggagggcgaggagcacaggttgtgtgaaggcatcgggcctgtgaatatctctgtc
agcagctccaaaggtgccgtactctacgagccctgtgtgatgggcacgcccatgctgagg
accgaatactgcaccgggaccacgggtgtcctgaggaacagtgggggctgcaacgtggtg
ggcaccggtgaactctacatcccctgcgagccccaagggctcctgggctgtggaaatggg
cggagctccagcatgaaggtgggggtgggtagcaattcgtgcagccgctag

DBGET integrated database retrieval system