KEGG   Mus musculus (mouse): 114584
Entry
114584            CDS       T01002                                 

Gene name
Clic1, Cl, Clcp, G6
Definition
(RefSeq) chloride intracellular channel 1
  KO
K05021  chloride intracellular channel protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    114584 (Clic1)
   04040 Ion channels [BR:mmu04040]
    114584 (Clic1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   114584 (Clic1)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel, intracellular (CLIC)
   114584 (Clic1)
SSDB
Motif
Pfam: GST_C_2 GST_N_2 GST_N_3 GST_C GST_N_4 GST_C_3
Other DBs
NCBI-GeneID: 114584
NCBI-ProteinID: NP_254279
MGI: 2148924
Ensembl: ENSMUSG00000007041
Vega: OTTMUSG00000037145
UniProt: Q9Z1Q5 Q542F1
Position
17 B1; 17 18.58 cM
AA seq 241 aa
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCP
GGQLPFLLYGTEVHTDTNKIEEFLEAMLCPPRYPKLAALNPESNTSGLDIFAKFSAYIKN
SNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGISQRKFLDGNELTLADCNL
LPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVARAL
K
NT seq 726 nt   +upstreamnt  +downstreamnt
atggctgaagaacaacctcaggtcgaactgttcgtgaaggctggcagtgatggtgccaag
attgggaactgccccttctcccagagactgttcatggtgctctggctcaagggagtcacc
ttcaacgttaccactgtggacaccaagagacggacagagactgtacagaagctctgcccc
ggtgggcagctgccgttcttgctctatggcaccgaagtgcacacagacaccaacaagatc
gaggaattcctggaggccatgctgtgccctcccaggtacccaaagctggctgccctgaac
cctgagtccaacacctcgggactggacatatttgcaaagttttctgcctacatcaagaac
tcaaacccagccctcaatgacaacctagagaagggactcctgaaagccctgaaggttcta
gacaattacctgacatcccccctcccagaagaagtggatgaaaccagcgccgaagatgag
ggcatctctcagaggaagtttctggacggcaatgagctcaccctggctgactgcaacctg
ctgccaaagcttcacatagtacaggtggtgtgcaaaaagtacagaggcttcaccatccca
gaggcattccgtggagtgcatcggtacttgagcaacgcttatgcccgggaagaatttgcc
tccacctgtccagatgatgaagagatagagctagcctatgagcaagtggccagggctctc
aaatga

DBGET integrated database retrieval system