KEGG   Mus musculus (mouse): 114585
Entry
114585            CDS       T01002                                 

Gene name
D17H6S53E, G4, NG3, NG34
Definition
(RefSeq) DNA segment, Chr 17, human D6S53E
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4661
Other DBs
NCBI-GeneID: 114585
NCBI-ProteinID: NP_258438
MGI: 90673
Ensembl: ENSMUSG00000043311
Vega: OTTMUSG00000037181
UniProt: Q9Z1R4 B2RS43
Position
17 B1; 17 18.59 cM
AA seq 293 aa
MFLRRLGGWLPRPWGRKKSTKADLPAPEPRWVDSSPENSGSDWDSAPETMGDVGPLKTKD
SGTRRPPGAAPESSRDLKVDQLGSKRMDSLKRDKTASTIQEPARLESGGAIPKLDWDPVD
SGGVKNLGVSAQGRLGTIGPEALLEKPGRRQKLLRWLRGEPGAPSHYLQDPEEYLQISTN
LTLHLLELLATALLALCSRPLRAILDALGLRGPVGLWLHGLLCFLAALHGLHAVLSLLTA
HPLHFACLFGLLQALVLAVSLREPVEDEETADWESEGQEREAKEQREGPGRML
NT seq 882 nt   +upstreamnt  +downstreamnt
atgttccttcgacggcttggtggctggctacctcgaccttggggtcgaaagaaatcaaca
aaggctgatttgcctgccccagaacccagatgggtggacagctccccggagaattcgggg
agtgactgggacagtgctccagagaccatgggagatgtggggccccttaagaccaaggat
tcaggaacacggagaccccccggggctgctccagagtctagcagggacctcaaagtggat
caactggggagcaaaagaatggattccctcaagcgggacaagactgcctctaccattcaa
gagcctgcaagactggagtctggaggggccattcccaaactagactgggatcctgtggat
tcaggtggcgtgaagaaccttggagtgtccgctcaagggagactaggcaccattgggcca
gaagccctgttggagaaacctggtcgccgtcagaagctgctgcgttggttacggggggaa
ccaggggctccttcacattacctgcaggacccagaggagtacctgcagatctctaccaac
ttgaccctgcacctgctggagctgcttgccacagccctgctggctctgtgctccaggcca
ctccgagccatcttggatgctttgggccttcgaggacctgtgggcctctggcttcatggg
ctgctatgtttcctggccgccctacatgggctccacgctgtgctgagcttacttactgcc
caccccctgcattttgcctgcctctttggcttgttgcaggccctggtgctggctgtcagc
ctccgggaacctgttgaagatgaggagaccgctgattgggagagtgaggggcaggagagg
gaggccaaggagcagagggaaggtcccggaaggatgttgtga

DBGET integrated database retrieval system