KEGG   Mus musculus (mouse): 114601Help
Entry
114601            CDS       T01002                                 

Gene name
Ehbp1l1, G430002G23Rik
Definition
(RefSeq) EH domain binding protein 1-like 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3585 CH NT-C2 CAMSAP_CH
Motif
Other DBs
NCBI-GeneID: 114601
NCBI-ProteinID: NP_444482
MGI: 3612340
Ensembl: ENSMUSG00000024937
UniProt: Q99MS7
Position
19; 19 A
AA seq 877 aa AA seqDB search
MTSVWKRLQRVGKRAAKFQFVACYHELVLECTKKWQPDKLVVVWTRRNRRICSKAHSWQP
GIQNPYRGTVVWMVPENVDISVTLYRDPHVDQYETKEWTFIIENESKGQRKVLATVDVNL
AHHAGPVPAQVPLRLRLKPKSVKVVHAELSLTLSGVLLREGRATDDDMQSLASLMSVKPS
DVGNLDDFAESDEEEANGPGAPEVRTRGPQSDLSRELKTLCEEEDEGHIRPQQAAARPSS
AEDTSPAPVSAPAPPVRAFRGQGSEPAAITGGQVGPETPEPPPSPPETRSTGQPGQTMVP
TPAPRLRKGSDAPSSPVPCSGDEVPNTSEDPPTGMGSSGETQAQISSQEGTEAHEARPEP
DIEAPPTLVSSSQSLLEWCQEVTNGYRGVCITNFTTSWRNGLAFCAILHRFYPDKIDYFS
LDPLNIKQNNKQAFDGFAALGVSRLLEPADMVLLSVPDKLIVMTYLCQIRAFCTGQELQL
VQLEGGGGSGTYRVGNAQPSLPDCLDAGDLAQRLREHGAEVPTEPKEAVNRGTGAIPKVA
SRDTDLSCSSKDGEAEVAQEAIPQEAPTDGPRARSSTTPVVPAEGLVNGVGASGGVSGVR
LRRSSVNGEAGPVPPPRAHGSFSHVRDADLLKKRRSRLRNSNSFSVDDQDSGAAVGAGPA
GPGAVEGPNPASSPDANPLPAPAPQQPPGGPPPTEESSPSLGEETGLQRFQDTSQYVCAE
LQALEQEQGQIDGRAAEVEKQLRSLMESGANRLQEEVLIQEWFTLVNKKNALIRRQDQLQ
LLIEEQDLERRFELLSRELRAMLAIEEWQKTVAQQHREQLLLEELVSLVNQRDELVRDLD
QKERIALEEDERLERGLEQRRRKVSRQLSRRERCTLS
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagtgtggaagcgcctgcagcgggttggcaagcgggccgccaagttccagttt
gtggcgtgttaccatgaactggtgttggagtgcaccaagaagtggcagcctgacaagctg
gtggtggtatggactcggcggaaccgaaggatctgctccaaggcccacagctggcagcct
ggcatccagaacccataccgtggcaccgtggtatggatggttcctgagaacgtggacatc
tcggtgaccttgtacagggaccctcatgtggaccagtatgaaaccaaagagtggactttt
attattgaaaatgagtccaagggacagcggaaggtactggccacagttgatgtgaaccta
gcccaccatgcagggcctgtgcctgctcaggttccacttcgactgcggctgaagcccaaa
tctgtgaaggtggtgcatgccgaactgagcctcaccctttctggggtgctgctgcgagaa
ggccgtgccacggatgatgacatgcagagtctggccagcctcatgagtgtgaagcctagt
gacgtgggaaacctggatgactttgctgagagtgatgaggaggaagctaatggccctggg
gctcctgaggtccggactcgaggcccccagtcagatctgtctcgagagctgaagacactc
tgtgaagaagaagatgaaggccacatacggccccagcaggcagctgccagaccctctagt
gctgaagacaccagccctgccccagtgagtgcccctgcacccccggtcagggccttccgg
ggccaggggtcagaaccagctgctataaccgggggccaggtggggcctgaaaccccagag
cccccgccatccccaccagagacaaggtccactgggcagccaggccagaccatggtcccc
accccagcccctcggctccggaaaggctctgatgcaccctcgtccccagtcccctgcagt
ggggatgaggtccccaatacctcagaggatcctccaacaggaatgggctcttctggggag
acccaggctcagataagctctcaggaagggacagaggcccatgaagccaggccagaacca
gacattgaggcaccacctaccctggtcagctccagccagtccctgttggagtggtgccaa
gaggtcaccaacggctaccgtggtgtctgcatcaccaacttcaccacgtcctggcgcaat
ggcctggccttctgtgctattttacatcgattctacccagacaagatcgattatttctcc
cttgatcccctcaacatcaaacagaacaacaagcaggcttttgatggcttcgctgccctg
ggtgtgtctcggctgctcgagccggcggacatggtacttctgtccgtacctgacaagctc
atcgtcatgacgtacctgtgccagatccgtgccttctgcactgggcaggagctgcagctg
gtgcaactggagggcggcggtggctctggcacttatcgtgtgggcaacgcccagccgagc
ctgcccgactgtctggacgcaggagacctggcgcagcgattacgcgagcatggggctgaa
gtgcccacagaacctaaggaggctgtgaaccgcgggactggggcaataccaaaggtggcc
tccagggacacggacctgagctgctcctctaaggatggggaggcagaggttgcccaggaa
gcaatccctcaagaggcgcccaccgacggccctagagccaggtcgtccacaaccccggtg
gtccctgcagaggggctggtgaacggagtgggggcgtcaggtggtgtgagtggtgtgaga
ctgagacggtcctctgtcaatggggaggctgggccagtacctccaccccgagcacatggc
tctttctcccacgtgcgggacgccgatttgctaaagaagaggcgatcgaggttaaggaat
agcaactctttctctgtggatgaccaggactctggagctgcagttggagcagggcctgca
gggcctggagctgtggaaggtccaaaccctgcctccagccctgacgctaacccactccca
gccccagccccacagcagccgcccggtgggccccctcctactgaggagtcatcacccagc
ctgggggaagagacaggcctgcaacggttccaggacacaagtcagtacgtgtgcgcagag
ctgcaagccctggagcaggaacagggacagatagatgggagggccgctgaggtggagaag
cagctgaggagcctcatggaatcaggtgccaacaggctgcaggaggaggtgctgattcag
gaatggttcaccctggtcaacaagaagaatgcgctcatccggaggcaggaccagctgcag
ctgctcatcgaggagcaggacttggagcggaggtttgaactgctgagccgagagttgcgg
gccatgctggccattgaagagtggcagaaaacagttgcgcagcagcaccgcgagcaactc
ctgttggaggagctggtgtctctggtgaaccagagggatgaactggtccgggacctggac
cagaaggaacggatcgctctggaggaagatgagcgcctagaacgaggcctggagcagaga
cgtcgcaaggtgagccggcagctgagcaggcgggaacgctgtaccctgagctga

DBGET integrated database retrieval system