KEGG   Mus musculus (mouse): 11461Help
Entry
11461             CDS       T01002                                 

Gene name
Actb, Actx, E430023M04Rik, beta-actin
Definition
(RefSeq) actin, beta
  KO
K05692  actin beta/gamma 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04145  Phagosome
mmu04210  Apoptosis
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04611  Platelet activation
mmu04670  Leukocyte transendothelial migration
mmu04714  Thermogenesis
mmu04810  Regulation of actin cytoskeleton
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04971  Gastric acid secretion
mmu05100  Bacterial invasion of epithelial cells
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05164  Influenza A
mmu05205  Proteoglycans in cancer
mmu05225  Hepatocellular carcinoma
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
mmu05416  Viral myocarditis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    11461 (Actb)
   04390 Hippo signaling pathway
    11461 (Actb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    11461 (Actb)
  09143 Cell growth and death
   04210 Apoptosis
    11461 (Actb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    11461 (Actb)
   04520 Adherens junction
    11461 (Actb)
   04530 Tight junction
    11461 (Actb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    11461 (Actb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    11461 (Actb)
   04670 Leukocyte transendothelial migration
    11461 (Actb)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    11461 (Actb)
   04919 Thyroid hormone signaling pathway
    11461 (Actb)
  09154 Digestive system
   04971 Gastric acid secretion
    11461 (Actb)
  09159 Environmental adaptation
   04714 Thermogenesis
    11461 (Actb)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    11461 (Actb)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    11461 (Actb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    11461 (Actb)
   05410 Hypertrophic cardiomyopathy (HCM)
    11461 (Actb)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    11461 (Actb)
   05414 Dilated cardiomyopathy (DCM)
    11461 (Actb)
   05416 Viral myocarditis
    11461 (Actb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    11461 (Actb)
   05135 Yersinia infection
    11461 (Actb)
   05100 Bacterial invasion of epithelial cells
    11461 (Actb)
  09172 Infectious disease: viral
   05164 Influenza A
    11461 (Actb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    11461 (Actb)
   03019 Messenger RNA biogenesis [BR:mmu03019]
    11461 (Actb)
   03036 Chromosome and associated proteins [BR:mmu03036]
    11461 (Actb)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    11461 (Actb)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    11461 (Actb)
   04147 Exosome [BR:mmu04147]
    11461 (Actb)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     11461 (Actb)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     11461 (Actb)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     11461 (Actb)
    NuA4 complex
     11461 (Actb)
  Chromatin remodeling factors
   BAF complex
    11461 (Actb)
   PBAF complex
    11461 (Actb)
   SWR1 complex
    11461 (Actb)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    11461 (Actb)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     11461 (Actb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   11461 (Actb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 11461
NCBI-ProteinID: NP_031419
MGI: 87904
Ensembl: ENSMUSG00000029580
Vega: OTTMUSG00000035960
UniProt: P60710 B2RRX1
Position
5 G2; 5 81.8 cM
AA seq 375 aa AA seqDB search
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgatatcgctgcgctggtcgtcgacaacggctccggcatgtgcaaagccggc
ttcgcgggcgacgatgctccccgggctgtattcccctccatcgtgggccgccctaggcac
cagggtgtgatggtgggaatgggtcagaaggactcctatgtgggtgacgaggcccagagc
aagagaggtatcctgaccctgaagtaccccattgaacatggcattgttaccaactgggac
gacatggagaagatctggcaccacaccttctacaatgagctgcgtgtggcccctgaggag
caccctgtgctgctcaccgaggcccccctgaaccctaaggccaaccgtgaaaagatgacc
cagatcatgtttgagaccttcaacaccccagccatgtacgtagccatccaggctgtgctg
tccctgtatgcctctggtcgtaccacaggcattgtgatggactccggagacggggtcacc
cacactgtgcccatctacgagggctatgctctccctcacgccatcctgcgtctggacctg
gctggccgggacctgacagactacctcatgaagatcctgaccgagcgtggctacagcttc
accaccacagctgagagggaaatcgtgcgtgacatcaaagagaagctgtgctatgttgct
ctagacttcgagcaggagatggccactgccgcatcctcttcctccctggagaagagctat
gagctgcctgacggccaggtcatcactattggcaacgagcggttccgatgccctgaggct
cttttccagccttccttcttgggtatggaatcctgtggcatccatgaaactacattcaat
tccatcatgaagtgtgacgttgacatccgtaaagacctctatgccaacacagtgctgtct
ggtggtaccaccatgtacccaggcattgctgacaggatgcagaaggagattactgctctg
gctcctagcaccatgaagatcaagatcattgctcctcctgagcgcaagtactctgtgtgg
atcggtggctccatcctggcctcactgtccaccttccagcagatgtggatcagcaagcag
gagtacgatgagtccggcccctccatcgtgcaccgcaagtgcttctag

DBGET integrated database retrieval system