KEGG   Mus musculus (mouse): 114615
Entry
114615            CDS       T01002                                 

Symbol
Elac1, 2610018O07Rik, 8430417G19Rik
Name
(RefSeq) elaC ribonuclease Z 1
  KO
K00784  ribonuclease Z [EC:3.1.26.11]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    114615 (Elac1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.11  tRNase Z
     114615 (Elac1)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  3'processing and CCA adding factors
   3'processing factors
    114615 (Elac1)
 Prokaryotic type
    114615 (Elac1)
SSDB
Motif
Pfam: Lactamase_B_2 Lactamase_B Lactamase_B_4
Other DBs
NCBI-GeneID: 114615
NCBI-ProteinID: NP_444485
MGI: 1890495
Ensembl: ENSMUSG00000036941
Vega: OTTMUSG00000029778
UniProt: Q8VEB6
Position
18; 18 E2
AA seq 362 aa
MSMDVTFLGTGAAYPSPTRGASAVVLRCEGECWLFDCGEGTQTQLMKSQLKAGRITKIFI
THLHGDHFFGLPGLLCTISLQSGSVVARQPIEIYGPVGLRDFIWRTMELSHTELVFPYVV
HELVPTADQCPVEELREFAHMDETDSSPKGQGRTILLDAEENSYCLVDDEQFVVKAFRLF
HRIPSFGFSVVEKKRAGKLNAQKLRDLGVPPGPAYGKLKNGISVVLDNGVTISPQDVLKK
PMVGRKVCILGDCSGVVGDGGVKLCFEADLLIHEATLDDSQMDKAREHGHSTPQMAAAFA
KLCRAKRLVLTHFSQRYKPTALAREGEADGIAELRKQAEAVLELQEVTLAEDFMVIGIPI
KK
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgtctatggatgtgacctttcttgggacaggagcagcatatccatcaccgacccgtggc
gcctctgcggtggttcttcggtgcgagggcgagtgctggctctttgactgtggggaggga
acacagacccagcttatgaaaagccagcttaaagcagggagaattaccaagatcttcatc
acacatctccatggcgaccacttctttggccttccaggcctcctctgtaccatcagcctg
cagagtggctctgtggtcgccaggcagcctattgagatctacggccccgtcgggcttcgg
gactttatctggagaaccatggagctctctcacacggagttggtgtttccttacgtggtt
cacgagctagttcctacagctgaccagtgtcctgtagaagaactgagagaatttgcacac
atggatgaaacagacagctctcccaaaggacaaggacgaactatcttgctagatgcagaa
gaaaactcatactgtctggttgatgacgagcagtttgtggtaaaagcatttcgcctcttt
catagaattccatcctttggcttttcagttgtggaaaagaagcgtgcaggtaaactcaac
gcacagaagctgagagatctcggtgtgccaccaggtcctgcctatgggaagctgaaaaac
ggaatttctgttgttttggataatggagttacaatttctccccaagacgtcttaaaaaag
cctatggttggaagaaaagtttgcatcctgggtgactgttctggggttgtgggtgacggg
ggcgtgaagctgtgctttgaggccgacctgctgatccacgaggccactctggatgattcc
cagatggacaaagcgagagagcacggccacagcacgccgcagatggcagcggcgtttgca
aagctgtgccgtgccaagaggctagttctgacccacttcagtcagaggtacaaaccaacc
gccttggcgagagaaggggaggcagacggcatcgcagagctgaggaagcaagcagaggcc
gtgttagagctccaagaagtgactctagcagaagattttatggtgatcggcattccgatc
aagaaatga

DBGET integrated database retrieval system