KEGG   Mus musculus (mouse): 114643
Entry
114643            CDS       T01002                                 

Gene name
Oas1c, O, Oasl2, Oasl5
Definition
(RefSeq) 2'-5' oligoadenylate synthetase 1C
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: OAS1_C SMODS NTP_transf_2 tRNA_NucTransf2 Nrap_D5
Other DBs
NCBI-GeneID: 114643
NCBI-ProteinID: NP_291019
MGI: 2149633
Ensembl: ENSMUSG00000001166
Vega: OTTMUSG00000026817
UniProt: Q924S2
Position
5 F; 5 60.64 cM
AA seq 362 aa
MENGLCSIQARELDEFICDYLFPDTTFLTELRADIDSISAFLKERCFQGAAHPVRVSRVV
MGGSYDEHTALKGKSEAKMVLFFNNLTSFEEQLKRRGEFVEEIQKHLCQLQQEKPFKVKF
EVQSSEEPNSRSLSFKLSSPELQQEVEFDVQPAYDVLYELRNNTYAEPQFYNKVYAQLIH
ECTTLEKEGDFSICFTDLHQNFMRYRAPKLWNLIRLVKHWYQLCKEKLREPLPPQYALEL
LTVYVWEHSNKNQEKVTTAKNFRTFLELVAYYKNLRIYWTWYYDFRHQEVCAYLCRQLKK
ARPLILDPADPTRNVAGSDLQAWDLLAKEAQTWMQSSCFRNCDMSFVPTWDLSPERQECA
FQ
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggagaatggtctctgcagcatccaagccagggagctggacgagttcatatgtgattac
ctctttcctgacaccaccttccttactgagctcagagcagacatcgactccataagtgct
ttcctgaaggagagatgcttccaaggtgccgcccatcctgtgagggtctccagggttgtg
atgggcggctcctatgatgaacacactgcactcaagggcaagtcagaggccaaaatggtg
ttgttctttaacaatctcaccagctttgaggagcagttaaagcgacggggagagttcgtt
gaggaaattcagaaacacctgtgtcagctgcagcaagagaaaccatttaaagtgaagttt
gaggtgcagagctcagaggagcccaactccaggtctctgagcttcaagctgagctccccc
gagctccagcaggaggtggaatttgatgtgcagccagcctatgatgtcctatatgaactg
agaaacaacacgtatgctgaaccccaattctacaacaaagtctacgcccaactcatccat
gagtgcaccaccctggagaaggagggcgatttctccatctgcttcaccgacctccatcag
aacttcatgaggtatcgtgcgcccaagctctggaacctcatccgtctggtcaagcactgg
tatcaactgtgtaaggagaagctgagggagccgctgcccccacagtacgccctggagctg
ctcactgtctatgtatgggaacattcgaataaaaatcaagaaaaagtaaccacagccaag
aacttccggaccttcttagaactggtcgcctattacaagaatcttcgaatctactggaca
tggtattatgacttccgacatcaagaggtctgtgcctacctgtgcagacagctcaaaaaa
gccaggcctctgatcctggatccagcagacccaacaaggaacgtggctggttcagactta
caggcatgggacctgctggcaaaggaggctcagacctggatgcagtcctcttgctttaga
aactgtgatatgtcctttgtgcccacctgggatttgtcgccagagagacaagaatgtgcc
ttccagtga

DBGET integrated database retrieval system