KEGG   Mus musculus (house mouse): 114644
Entry
114644            CDS       T01002                                 
Symbol
Slc13a3, NaDC-3, NaDC3, SDCT2
Name
(RefSeq) solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3
  KO
K14445  solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2/3/5
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    114644 (Slc13a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC13: Human Na+-sulfate/carboxylate cotransporter
   114644 (Slc13a3)
SSDB
Motif
Pfam: Na_sulph_symp CitMHS
Other DBs
NCBI-GeneID: 114644
NCBI-ProteinID: NP_473396
MGI: 2149635
Ensembl: ENSMUSG00000018459
UniProt: Q91Y63 Q3UUJ6
Position
2:complement(165247215..165315117)
AA seq 600 aa
MAALAALAKKVWSARRLLVLLLVPLALLPILFALPPKEGRCLYVILLMAVYWCTEALPLS
VTALLPIILFPFMGILPSSKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKVLMLV
GVQPARLILGMMVTTSFLSMWLSNTASTAMMLPIASAILKSLFGQREARKDLPREGDEST
AAVQGNGLRTVPTEMQFLASSEGGHTEDAEAPMELPDDSKEEEHRRNIWKGFLISIPYSA
SIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFIFAFPLMLLFLLVGWLWISFLYG
GMSWRSWRKKKSKIRADAEDQAKAVIQEEFQNLGPIKFAEQAVFILFCTFAILLFSRDPK
FIPGWASLFAPGFVSDAVTGVAIVTILFFFPSQKPSLKWWFDFKAPNSETEPLLSWKKAQ
ETVPWNIILLLGGGFAMAKGCEESGLSAWIGGQLHPLEHVPPLLAVLLITVVIAFFTEFA
SNTATIIIFLPVLAELAIRLHVHPLYLMIPGTVGCSYAFMLPVSTPPNSIAFSTGHLLVK
DMVRTGLLMNLMGVLLLSLAMNTWAQTIFQLGTFPDWANTHAANATALPPALTNNTVQTF
NT seq 1803 nt   +upstreamnt  +downstreamnt
atggcggcgctggcggcgctggccaagaaggtgtggagcgcgcggcgcctcctggtgctg
ctgctggtgccgctggctctgctgcccattctcttcgccctgccgcccaaggaaggccga
tgcctctatgtcatcctgctcatggcggtgtactggtgcacagaggccctgcccctgtca
gtgacagctcttctgcccatcatcctcttccccttcatgggcattctgccctccagcaag
gtctgcccccagtacttcctcgacaccaacttcctcttccttagcggcctgatcatggcc
agcgccatagaggaatggaacttgcaccggagaatcgccctcaaggtcctcatgctggtt
ggggtccagcctgcaaggctcatcctggggatgatggtgaccacgtcattcctgtctatg
tggctgagcaacacggcctccaccgcaatgatgctacccattgccagtgccatcctcaag
agcctctttggccagcgcgaagctcggaaggaccttccccgggaaggcgacgagagcaca
gctgctgtgcagggaaatggactgcgaacagtgcccacggagatgcagtttcttgccagt
tcggaaggaggtcacactgaggatgcagaggccccgatggagctgcctgatgactccaag
gaggaggaacaccgcagaaacatctggaagggcttcctcatttccattccttactctgcc
agcattgggggcactgccaccctcacgggcaccgcccccaacctcatcctgctcggccag
ctcaagagtttcttcccacagtgtgatgtggtgaattttggctcctggttcatcttcgcc
ttccctctcatgctgttgttcctactggtgggctggctctggatctccttcctctatggt
ggaatgagctggagaagttggaggaagaagaaatccaagatacgagctgacgcagaggat
caggctaaagcggtgatccaggaggagttccagaacctggggcccatcaagtttgctgaa
caggccgtcttcatcttgttctgcacgtttgccatcctcctcttctcccgggaccccaag
ttcatccctggctgggccagcctcttcgcccctgggtttgtctcggatgctgtcaccggt
gtggccattgtcaccatcctgttcttcttcccttcccagaagccctcactcaagtggtgg
tttgacttcaaagctcccaactcggagacggagcccctgctgagctggaagaaggcccag
gagacagtgccctggaacattatccttcttctaggaggtggctttgccatggccaagggc
tgtgaggagtctgggctatcagcatggatcggtggacagctgcaccccctggagcatgtc
cccccactgctggcagtgctgctcatcaccgtggtcatcgccttcttcacggagtttgcc
agcaacacggccaccatcatcatcttcctgcccgtcctggcagagctggccatccgactg
catgtgcaccccttgtacctgatgatcccaggcacggtcggctgctcctacgccttcatg
ctgccggtctcaacacccccaaactccattgccttctctactggacacttgctggtcaaa
gacatggtgcggacgggcctgctgatgaacctgatgggtgtcctgctgctcagcctggcc
atgaacacctgggcacagaccatcttccagctgggcaccttcccagactgggccaacacc
catgctgctaacgccaccgcactgccaccagccttgaccaacaacacagttcaaaccttc
tga

DBGET integrated database retrieval system