KEGG   Mus musculus (house mouse): 114661
Entry
114661            CDS       T01002                                 
Symbol
Prss28, Isp1, mIsp-1
Name
(RefSeq) protease, serine 28
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 114661
NCBI-ProteinID: NP_444489
MGI: 2149951
Ensembl: ENSMUSG00000024171
UniProt: Q924N9 A0A0R4IZZ8
Position
17:25527620..25530850
AA seq 274 aa
MFRLLLLALSCLESTVFMASVSISRSKPVGIVGGQCTPPGKWPWQVSLRMYSYEVNSWVH
ICGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGEVYLYKEQELLNISRIIIHPDYNDVS
KRFDLALMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHE
VKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCAGTSGRGPCFGDSGGPLVCWKSNKWI
QVGVVSKGIDCSNNLPSIFSRVQSSLAWIHQHIQ
NT seq 825 nt   +upstreamnt  +downstreamnt
atgttcagactgttgctcctggctctctcctgtctggaaagtaccgtgttcatggcctct
gtatctatctccagaagcaagccagtgggcattgtggggggtcaatgtaccccaccaggg
aagtggccatggcaggtcagcctaagaatgtacagttacgaggtgaactcctgggtgcac
atctgtgggggctccatcatccaccctcagtggattctgactgctgctcactgcatccaa
agtcaggacgccgacccagccgtataccgggtccaggtgggggaagtatacctctataag
gagcaggaacttctgaacatcagcaggatcatcatccaccctgactacaacgatgttagt
aagaggtttgacttggccctgatgcagttgactgccctcctggtcacatccacaaatgtc
agtccagtctctctgccaaaagacagctcaaccttcgactccactgaccagtgttggctg
gttggctggggcaaccttctccaacgtgtgcctctgcagcctccctatcaactgcatgag
gtgaagatcccaattcaggacaacaagagctgtaagcgggcttataggaagaagtcatcc
gacgagcacaaagctgtggccatctttgacgacatgctttgtgctggcacctcaggccga
ggcccctgttttggtgactctgggggtcccttggtctgctggaagagcaacaagtggata
caggtgggcgtggtcagcaaggggatcgattgcagcaacaatctgccatcaatcttctca
agagtccagagctccttagcctggatccatcaacacatccagtag

DBGET integrated database retrieval system