KEGG   Mus musculus (mouse): 114662
Entry
114662            CDS       T01002                                 

Gene name
Prss29, D19363, I, Isp2, mIS, mISP-2
Definition
(RefSeq) protease, serine 29
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 DUF316
Other DBs
NCBI-GeneID: 114662
NCBI-ProteinID: NP_444490
MGI: 2149952
Ensembl: ENSMUSG00000034039
UniProt: Q99MS4 E9QLD5
Position
17 A3.3; 17 12.53 cM
AA seq 279 aa
MLIQLCLTLFFLGCSIAGTPAPGPEGVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVH
NCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAG
LGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQ
VQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDSGGPLVCNVTGSW
TLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQRFS
NT seq 840 nt   +upstreamnt  +downstreamnt
atgctgatccagctgtgcctgaccctcttctttcttgggtgctccattgctggaacccca
gcacctgggcctgagggcgttctgatgggcatcgtggggggtcatagtgccccacagggg
aagtggccatggcaggtcagcctgaggatctatagatactactgggccttctgggtgcac
aactgtgggggctccatcatccacccacagtgggtgctgactgctgcccactgcattcgt
gagagagatgccgacccatcagtctttcggatccgtgttggggaggcgtacctctatggg
ggcaaggagctgctgagtgtgagccgggtcatcatccacccagactttgtccacgctggc
ctgggttcagatgtggctctgctccagctggcagtgtctgtacaatcctttcctaatgtc
aagccagtcaagctgccctctgagtctcttgaggtcaccaagaaggatgtgtgctgggtg
accggctggggtgcagtgagcacacacaggtcgctgcctcctccctaccgcctacagcag
gtgcaggtaaagataattgacaactcactttgtgaggagatgtaccacaatgccaccagg
caccgcaatcgtggccagaaactgatcctaaaggacatgttatgtgcaggcaaccagggc
caagattcctgctatggtgactcaggtggccctctggtctgcaatgtgacaggctcctgg
accctggtgggagtggtgagctggggctatggctgtgccctcagggacttccctggggtc
tatgcacgtgtacagtccttcctgccctggatcacgcagcagatgcagaggttctcctga

DBGET integrated database retrieval system