KEGG   Mus musculus (mouse): 11472Help
Entry
11472             CDS       T01002                                 

Gene name
Actn2, 1110008F24Rik
Definition
(RefSeq) actinin alpha 2
  KO
K21073  actinin alpha 2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09166 Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    11472 (Actn2)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    11472 (Actn2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     11472 (Actn2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11472 (Actn2)
  Exosomal proteins of colorectal cancer cells
   11472 (Actn2)
  Exosomal proteins of bladder cancer cells
   11472 (Actn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spectrin CH EFhand_Ca_insen CAMSAP_CH EF-hand_1 EF-hand_8 EF-hand_7 EF-hand_6 XisI EF-hand_11 HisKA_2
Motif
Other DBs
NCBI-GeneID: 11472
NCBI-ProteinID: NP_150371
MGI: 109192
Ensembl: ENSMUSG00000052374
Vega: OTTMUSG00000017028
UniProt: Q9JI91 Q5FW75
Position
13 A1; 13 4.54 cM
AA seq 894 aa AA seqDB search
MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIE
NIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAE
EIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSW
KDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKP
DERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT
IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAF
MPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGK
EQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVN
DRCQKICDQWDRLGTLTQKRREALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQ
DMFIVHSIEEIQSLITAHEQFKATLPEADGERQSILAIQNEVEKVIQSYSIRISSSNPYS
TVTMDELRNKWDKVKQLVPVRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEI
ARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHI
RVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRA
CLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS
DKPYILAEELRRELPPDQAQYCIKRMPPYSGPGSVPGALDYTAFSSALYGESDL
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagatagagcccggcgtgcagtacaactatgtctacgacgaagatgagtatatg
atccaggaggaggagtgggaccgcgacctgctcctcgacccggcctgggagaagcagcag
aggaagacgttcactgcctggtgcaactcacacctgcggaaagctggcacccagatcgag
aacatcgaggaggatttcaggaacggcctcaagctcatgctacttctagaagtcatctca
ggggaaaggctgcccaaacctgaccggggaaaaatgcggttccacaagattgcgaatgtc
aacaaggctctggattacatagccagcaagggagtgaagctggtatctattggagctgaa
gaaatagtcgatggcaatgtgaagatgaccctgggtatgatctggaccatcatcctccgc
ttcgccattcaggacatctcagtggaagaaacatctgccaaagaagggctgctgctatgg
tgtcagaggaagacagctccatacagaaatgtgaatatccagaacttccacaccagctgg
aaagatggccttggactctgtgccctcatccacagacaccggcccgacctcattgactac
tcaaagcttaacaaggatgaccccataggaaacattaacctggccatggaaatagcagag
aagcacttggatatccctaagatgttggatgctgaagacattgtcaacactcccaaaccc
gatgaaagagccatcatgacttacgtttcctgcttctaccatgctttcgcgggagcggag
caggccgagacagcagctaacagaatatgtaaggttcttgctgtgaatcaagagaatgag
aggctgatggaagaatatgagaggctagcgagtgagctgttggagtggattcggcgcaca
atcccctggctggagaacaggacgcctgagaagaccatgcaggccatgcagaagaagctg
gaggacttccgggattaccgtcgtaagcataagccccccaaggtgcaggagaagtgccag
ctggagatcaacttcaacacgctgcagaccaagcttcggatcagcaaccggcccgccttc
atgccctccgagggcaagatggtgtcggacattgctggtgcctggcagaggttggagcag
gctgagaagggctatgaggagtggctattgaatgagattcgaagactggagcgcttggag
cacttggctgagaagttcaggcagaaggcctccacgcacgagacatgggcttatggcaaa
gaacagatcttgctgcagaaggactacgagtctgcgtccctgacggaagttcgagcccta
cttcggaagcacgaggcctttgagagcgacctggctgcacaccaggaccgcgtggagcag
atcgctgccattgcgcaggagctcaatgaactggactatcacgatgctgtgaacgtcaat
gatcggtgccagaaaatttgcgaccagtgggatagattggggacgctcacccagaagagg
agggaggccttggagagaactgagaagttgctggaaacaatcgaccaactgcacctggag
tttgccaagagagccgcgcccttcaacaactggatggagggagccatggaggacctgcag
gacatgttcattgtccacagcatcgaggagatccagagtctgatcactgcacatgagcag
ttcaaggccacactgcccgaggccgacggggagcggcagtccatcctggccatccagaac
gaggtggagaaggtgatccagagctacagcatccggatcagctccagcaacccctacagc
actgtcaccatggatgagctgcgcaacaagtgggacaaggtgaagcagctggtgccggtc
cgggatcagtccctgcaggaggagctggctcgccaacatgctaatgagcgtctgcggcgc
cagtttgctgctcaggccaatgccattgggccctggatccagaacaagatggaggagatc
gctcggagctccatccagatcaccggggccctggaggaccagatgaaccagctgaagcag
tacgaacacaacatcatcaactacaagaacaacatcgacaagctggagggcgaccaccag
ctcatccaggaggccctggtcttcgacaacaagcacacgaactacaccatggagcatatc
cgtgtcggatgggagttgctgctgacaactatcgccagaaccatcaatgaggtggagacc
cagatcctgacaagagatgccaagggcatcacccaggagcagatgaatgagttcagagcc
tccttcaaccactttgacaggaggaagaacggcctgatggatcatgaggatttcagagcc
tgcctcatttccatgggctatgacttgggtgaagctgaatttgcccgcattatgactttg
gttgaccccaacggacaaggcacggtcaccttccagtccttcattgacttcatgactaga
gagaccgcagacaccgacacggcagagcaggtcatcgcctccttccggattctggcttct
gataagccttacatcttggcagaggagcttcgtcgagagctgcctccggatcaggcccag
tactgcatcaagagaatgcccccatactcaggcccgggcagtgtccccggggccctggac
tacactgccttctcctctgccctctacggggaaagcgacctctaa

DBGET integrated database retrieval system