KEGG   Mus musculus (mouse): 11477
Entry
11477             CDS       T01002                                 

Gene name
Acvr1, ALK2, ActR-I, ActRIA, Acvr, Acvr1a, Acvrlk2, Alk-2, Alk8, D330013D15Rik, SKR1, Tsk7L
Definition
(RefSeq) activin A receptor, type 1
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    11477 (Acvr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    11477 (Acvr1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    11477 (Acvr1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    11477 (Acvr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11477 (Acvr1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     11477 (Acvr1)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   11477 (Acvr1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp APH FTA2
Other DBs
NCBI-GeneID: 11477
NCBI-ProteinID: NP_001103674
MGI: 87911
Ensembl: ENSMUSG00000026836
Vega: OTTMUSG00000012677
UniProt: P37172
Position
2; 2 C1.1
AA seq 509 aa
MVDGVMILPVLMMMAFPSPSVEDEKPKVNQKLYMCVCEGLSCGNEDHCEGQQCFSSLSIN
DGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
HLEVGLIILSVVFAVCLLACILGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTL
AELLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSR
DEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSIASGLAHLHIEIFGTQGKSAIAHRDLKSKNILVKKNGQCCIADLGLAVM
HSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQ
NPSARLTALRIKKTLTKIDNSLDKLKTDC
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggtcgatggagtaatgatccttcctgtgctaatgatgatggctttcccttccccgagt
gtggaagatgagaagcccaaggtcaaccagaaactttacatgtgtgtgtgtgagggcctc
tcctgcgggaacgaggaccactgtgaaggccagcagtgtttttcttctctgagcatcaac
gatggcttccacgtctaccagaagggctgctttcaggtttatgagcaggggaagatgacg
tgtaagaccccgccgtcacctggccaggctgtggagtgctgccaaggggactggtgtaac
aggaacatcacggcccagctgcccactaaagggaagtccttccccggaacacagaatttc
cacctggaagttggccttatcatcctctcggtggtgtttgcagtatgtcttttagcttgc
atccttggagttgctctcaggaagtttaagagacgcaatcaagagcgcctgaaccccaga
gacgtggagtatggtaccattgaagggctcatcaccaccaatgtgggagacagcactcta
gcggaactactagatcactcgtgtacatcaggaagtggctccggtcttcctttcctggta
cagagaacggtggctcgccagataaccctgttggagtgtgtcgggaagggccggtatgga
gaagtatggaggggcagctggcaaggcgaaaatgtcgctgtgaagatcttctcctcccga
gacgagaagtcatggttcagggagacggaattgtacaacactgtgatgttgaggcatgaa
aatatcttaggtttcatcgcttcagacatgacctccagacactccagtacccagctgtgg
ctcatcacacattaccatgaaatgggatcgttgtatgactaccttcagctcactactctg
gatacggttagctgccttcggattgtactgtccatagccagcggccttgcccatttgcac
atagagatatttgggacccaagggaagtccgccattgcccatcgagatctgaagagcaaa
aacatcctggtgaagaagaatggacagtgctgcatagcagatttgggcctggcagtcatg
cattcccagagcacaaaccagcttgatgtgggaaacaacccccgtgtggggaccaagcgc
tacatggctccggaagtgctcgatgaaaccatccaagtggattgctttgattcttataag
agggtcgatatttgggcctttggccttgttctgtgggaagtggccaggcgaatggtgagc
aatggtatagtggaagattacaagccaccattctatgatgtggttcccaatgacccaagt
tttgaagatatgaggaaagttgtctgtgtggatcaacagaggccaaacatacctaacaga
tggttctcagacccgacattaacttctctggcgaagctgatgaaagagtgctggtatcag
aacccatccgcaagactcacagctctacgtatcaaaaagactttgaccaaaatcgataat
tccctagacaaattaaaaactgactgttga

DBGET integrated database retrieval system