KEGG   Mus musculus (mouse): 11479Help
Entry
11479             CDS       T01002                                 

Gene name
Acvr1b, 6820432J04, ALK-4, ActR-IB, ActRIB, Acvrlk4, Alk4, SKR2
Definition
(RefSeq) activin A receptor, type 1B
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    11479 (Acvr1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    11479 (Acvr1b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    11479 (Acvr1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11479 (Acvr1b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     11479 (Acvr1b)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   11479 (Acvr1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Motif
Other DBs
NCBI-GeneID: 11479
NCBI-ProteinID: NP_031421
MGI: 1338944
Ensembl: ENSMUSG00000000532
Vega: OTTMUSG00000048171
UniProt: Q61271 Q3TZF1
Position
15 F1; 15 56.48 cM
AA seq 505 aa AA seqDB search
MAESAGASSFFPLVVLLLAGSGGSGPRGIQALLCACTSCLQTNYTCETDGACMVSIFNLD
GVEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPAHPS
MWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQ
DLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSRE
ERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT
IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRH
DAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG
GVHEDYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNVPNWWQSYEALRVMGKMMRECWYAN
GAARLTALRIKKTLSQLSVQEDVKI
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtcggccggagcctcctccttcttcccccttgttgtcctcctgctcgccggc
agcggcgggtccgggccccgggggatccaggctctgctgtgtgcgtgcaccagctgccta
cagaccaactacacctgtgagacagatggggcttgcatggtctccatctttaacctggat
ggcgtggagcaccatgtacgtacctgcatccccaaggtggagctggttcctgctggaaag
cccttctactgcctgagttcagaggatctgcgcaacacacactgctgctatattgacttc
tgcaacaagattgacctcagggtccccagcggacacctcaaggagcctgcgcacccctcc
atgtggggccctgtggagctggtcggcatcatcgccggccccgtcttcctcctcttcctt
atcattatcatcgtcttcctggtcatcaactatcaccagcgtgtctaccataaccgccag
aggttggacatggaggacccctcttgcgagatgtgtctctccaaagacaagacgctccag
gatctcgtctacgacctctccacgtcagggtctggctcagggttacccctttttgtccag
cgcacagtggcccgaaccattgttttacaagagattatcggcaagggccggttcggggaa
gtatggcgtggtcgctggaggggtggtgacgtggctgtgaaaatcttctcttctcgtgaa
gaacggtcttggttccgtgaagcagagatctaccagaccgtcatgctgcgccatgaaaac
atccttggctttattgctgctgacaataaagataatggcacctggacccagctgtggctt
gtctctgactatcacgagcatggctcactgtttgattatctgaaccgctacacagtgacc
attgagggaatgattaagctagccttgtctgcagccagtggtttggcacacctgcatatg
gagattgtgggcactcaagggaagccgggaattgctcatcgagacttgaagtcaaagaac
atcctggtgaaaaaaaatggcatgtgtgccattgcagacctgggcctggctgtccgtcat
gatgcggtcactgacaccatagacattgctccaaatcagagggtggggaccaaacgatac
atggctcctgaagtccttgacgagacaatcaacatgaagcactttgactccttcaaatgt
gccgacatctatgccctcgggcttgtctactgggagattgcacgaagatgcaattctgga
ggagtccatgaagactatcaactgccgtattacgacttagtgccctccgacccttccatt
gaggagatgcgaaaggttgtatgtgaccagaagctacggcccaatgtccccaactggtgg
cagagttatgaggccttgcgagtgatgggaaagatgatgcgggagtgctggtacgccaat
ggtgctgcccgtctgacagctctgcgcatcaagaagactctgtcccagctaagcgtgcag
gaagatgtgaagatttaa

DBGET integrated database retrieval system