KEGG   Mus musculus (mouse): 11481Help
Entry
11481             CDS       T01002                                 

Gene name
Acvr2b, 4930516B21Rik, AI047905, ActRIIB
Definition
(RefSeq) activin receptor IIB
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    11481 (Acvr2b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    11481 (Acvr2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    11481 (Acvr2b)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    11481 (Acvr2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11481 (Acvr2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     11481 (Acvr2b)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   11481 (Acvr2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Pkinase_fungal Toxin_TOLIP
Motif
Other DBs
NCBI-GeneID: 11481
NCBI-ProteinID: NP_031423
MGI: 87912
Ensembl: ENSMUSG00000061393
Vega: OTTMUSG00000062989
UniProt: P27040
Structure
PDB: 

Position
9; 9 F3
AA seq 536 aa AA seqDB search
MTAPWAALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCY
ASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPG
GPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEVRQCQR
WAGRRDGCADSFKPLPFQDPGPPPPSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAV
KIFPLQDKQSWQSEREIFSTPGMKHENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDY
LKGNIITWNELCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAV
LADFGLAVRFEPGKPPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWEL
VSRCKAADGPVDEYMLPFEEEIGQHPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVT
IEECWDHDAEARLSAGCVEERVSLIRRSVNGTTSDCLVSLVTSVTNVDLLPKESSI
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgccctgggcggccctcgcccttctctggggatcgctgtgcgccggttccggg
cgaggggaggctgagactcgggagtgcatctactacaacgccaactgggagctggagcgc
accaaccagagcggcctggagcgctgcgagggggaacaggacaagcggctgcactgctac
gcctcgtggcgcaacagctcgggcaccatcgagctggtgaagaagggctgctggctagat
gacttcaattgctacgacaggcaggagtgtgtggccaccgaggagaacccccaggtgtac
ttctgctgctgcgaaggcaacttctgcaacgagcgcttcacccacttgccggagcctggg
ggcccagaagtcacgtacgagccacccccgacagcccccaccctgctcacggtgctggcc
tactcgctgctgcccattggaggcctctctctcatcgtcctgctggccttctggatgtat
cgtcatcggaagcctccctacggccatgtggacatccatgaggtgagacagtgccagcgt
tgggcagggagaagggacggctgtgcggactcctttaagcccttgcctttccaggacccg
gggcctccgcccccatcccctctggtgggcctgaagccactacagctgctggagatcaag
gctcggggccgctttggctgcgtttggaaagctcagctcatgaacgactttgtggctgtg
aagatcttcccacttcaggacaagcagtcgtggcagagtgaacgggaaatcttcagcaca
cccggcatgaagcacgaaaacttgttgcagttcattgctgccgagaaacgaggctccaac
ctggaggtggagctgtggctcatcacagccttccacgacaagggctccctcacggattac
ctcaaggggaacatcatcacgtggaacgaactgtgccacgtggcggagacgatgtcacga
ggcctctcatacctgcatgaggatgtgccgtggtgtcgtggtgagggccacaagccttct
attgcccacagggacttcaaaagcaagaatgtactgctgaagagcgacctcaccgcggtg
ctggctgacttcggcctggctgttcggtttgagccagggaagcctcctggggatacccat
ggacaggttggcaccagacggtacatggcccctgaggtgctggaaggagccatcaacttc
cagagagacgccttcctgcgtatcgacatgtacgccatgggcctggtgctgtgggagctc
gtctctcggtgcaaggctgcagacgggcctgtcgatgagtacatgctgcccttcgaggag
gagattggccagcacccttcgctggaggagcttcaggaggtggttgtccacaagaagatg
aggcccacgattaaggatcactggctgaaacacccgggcctggcccagctctgcgtgacc
atcgaggagtgctgggaccatgatgcagaggctcgcctttctgcaggctgtgtagaagag
cgggtatccctgatcaggaggtcggtcaacggcactacctcggactgtctcgtctctctg
gtgacctccgtcaccaatgtggacctgctccctaaagagtccagcatctaa

DBGET integrated database retrieval system