KEGG   Mus musculus (mouse): 11482Help
Entry
11482             CDS       T01002                                 

Gene name
Acvrl1, AI115505, AI427544, Acvrlk1, Alk1
Definition
(RefSeq) activin A receptor, type II-like 1
  KO
K13594  activin receptor-like kinase 1 [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    11482 (Acvrl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11482 (Acvrl1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     11482 (Acvrl1)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   11482 (Acvrl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Pkinase_fungal APH Alpha_GJ DUF4381 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 11482
NCBI-ProteinID: NP_001264186
MGI: 1338946
Ensembl: ENSMUSG00000000530
Vega: OTTMUSG00000029275
UniProt: Q61288
Position
15; 15 F1
AA seq 502 aa AA seqDB search
MTLGSFRRGLLMLSVAFGLTRGDLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGR
HPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPL
ILGPVLALPVLVALGALGLWRVRRRQEKQRDLHSDLGESSLILKASEQADSMLGDFLDSD
CTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGSWHGESVAVKIFSSRDEQSWFR
ETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPQLALR
LAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSNLQCCIADLGLAVMHSQSSDY
LDIGNNPRVGTKRYMAPEVLDEHIRTDCFESYKWTDIWAFGLVLWEIARRTIINGIVEDY
RPPFYDMVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLT
ALRIKKTLQKLSHNPEKPKVIH
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaccttggggagcttcagaaggggccttttgatgctgtcggtggcctttggcctaacc
aggggagacttggcgaagccttccaagctggtgaactgcacttgtgagagcccacactgc
aagagaccattctgccaggggtcatggtgcacagtggtgctggttcgggagcagggcagg
cacccccaggtctatcggggctgcgggagcctgaaccaggagctctgcttgggacgtccc
acagagtttctgaaccatcactgctgctatagatccttctgcaaccacaacgtgtctctg
atgctggaggccacccaaactccttcggaggagccagaagttgatgcccatctgcctctg
atcctgggtcctgtgctggccttgccggtcctggtggccctgggtgctctaggcttgtgg
cgtgtccggcggaggcaggagaagcagcgggatttgcacagtgacctgggcgagtccagt
ctcatcctgaaggcatctgaacaggcagacagcatgttgggggacttcctggacagcgac
tgtactacgggcagcggctcggggctccccttcttggtgcagaggacggtagctcggcag
gttgcgctggtagagtgtgtgggaaagggccgatatggtgaggtgtggcgcggttcgtgg
catggcgagagtgtggcggtcaagattttctcctcacgagatgagcagtcctggttccgg
gagacggagatctacaacacagttctgcttagacacgacaacatcctaggcttcatcgcc
tccgacatgacttcgcggaactcgagcacgcagctgtggctcatcacccactaccatgaa
cacggctccctctatgactttctgcagaggcagacgctggagccccagttggccctgagg
ctagctgtgtccgcggcctgcggcctggcgcacctacatgtggagatctttggcactcaa
ggcaaaccagccattgcccatcgtgacctcaagagtcgcaatgtgctggtcaagagtaac
ttgcagtgttgcattgcagacctgggactggctgtgatgcactcacaaagcagcgattac
ctggatatcggcaacaacccccgagtgggtaccaaaagatacatggcacccgaggtgctg
gatgagcacatccgcacagactgctttgagtcgtacaagtggacagacatctgggccttt
ggcctagtgctatgggagatcgcccggcggaccatcatcaatggcattgtggaggattac
aggccacctttctatgacatggtacccaatgaccccagttttgaggacatgaaaaaggtg
gtgtgcgttgaccagcagacacccaccatccctaaccggctggctgcagatccggtcctc
tccgggctggcccagatgatgagagagtgctggtaccccaacccctctgctcgcctcacc
gcactgcgcataaagaagacattgcagaagctcagtcacaatccagagaagcccaaagtg
attcactag

DBGET integrated database retrieval system