KEGG   Mus musculus (house mouse): 114863
Entry
114863            CDS       T01002                                 
Symbol
Plpbp, 1700024N20Rik, 2200002F22Rik, Prosc
Name
(RefSeq) pyridoxal phosphate binding protein
  KO
K06997  PLP dependent protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    114863 (Plpbp)
SSDB
Motif
Pfam: Ala_racemase_N
Other DBs
NCBI-GeneID: 114863
NCBI-ProteinID: NP_473398
MGI: 1891207
Ensembl: ENSMUSG00000031485
Position
8:27530801..27546160
AA seq 274 aa
MLRGGSMTAELGVGFALRAVNERVQQSVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGH
GQRTFGENYVQELLEKASNPKILSSCPEIKWHFIGHLQKQNVNKLMAVPNLSMLETVDSV
KLADKVNSSWQKKGPTEPLKVMVQINTSGEDSKHGLLPSETIAVVEHIKASCPSLEFVGL
MTIGSFGHDLSQGPNPDFQRLLTLRRELCEKLGIPVEQVELSMGMSMDFQHAIEVGSTNV
RIGSTIFGERDYSKKPALDKTADAKASVPLVQGH
NT seq 825 nt   +upstreamnt  +downstreamnt
atgttgagaggtggcagcatgacggcggagctgggagtcgggttcgcgctgcgggccgtg
aacgagcgagtccagcagagtgtggcgcggcggccgcgggacctcccagccatccaaccc
cggctcgttgcggtcagcaaaacaaaacctgcagacatggtgatcgaggcctatggccac
ggccagcgcacttttggagagaactatgttcaggaactactagaaaaagcatcaaaccct
aagattctgtcttcctgtcccgagatcaagtggcacttcattggtcatttacagaaacaa
aacgtcaacaaactgatggccgtccccaacctctctatgctggaaaccgtagactcggtg
aagctggcagacaaggtgaatagctcctggcagaagaaaggtcctacagaaccactgaag
gtgatggtccagattaacaccagcggagaggacagtaaacacggcctgctgccttcagag
accatagctgtcgtggaacacataaaggccagttgtcccagcctggagttcgtgggtctc
atgaccataggaagctttggacatgatctaagtcaaggaccaaacccagacttccagagg
ctgctgaccctgcggcgggagctgtgtgaaaagctgggcattccggtggagcaggtggaa
cttagcatgggcatgtccatggacttccagcatgctattgaagtaggatctacaaatgtc
cggatagggagcactatttttggagagcgggactactcaaagaagcctgccctagacaag
acagcagacgcgaaggcctcagtaccactggtgcaaggacactga

DBGET integrated database retrieval system