KEGG   Mus musculus (mouse): 11489Help
Entry
11489             CDS       T01002                                 

Gene name
Adam12, Mltna
Definition
(RefSeq) a disintegrin and metallopeptidase domain 12 (meltrin alpha)
  KO
K06835  disintegrin and metalloproteinase domain-containing protein 12 [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    11489 (Adam12)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     11489 (Adam12)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   11489 (Adam12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin ADAM_CR Pep_M12B_propep Reprolysin_5 Disintegrin Reprolysin_3 Reprolysin_2 Reprolysin_4 Peptidase_M66 Zincin_1
Motif
Other DBs
NCBI-GeneID: 11489
NCBI-ProteinID: NP_031426
MGI: 105378
Ensembl: ENSMUSG00000054555
Vega: OTTMUSG00000021264
UniProt: Q61824
Position
7; 7 F3
AA seq 903 aa AA seqDB search
MAERPARRAPPARALLLALAGALLAPRAARGMSLWDQRGTYEVARASLLSKDPGIPGQSI
PAKDHPDVLTVQLQLESRDLILSLERNEGLIANGFTETHYLQDGTDVSLTRNHTDHCYYH
GHVQGDAASVVSLSTCSGLRGLIMFENKTYSLEPMKNTTDSYKLVPAESMTNIQGLCGSQ
HNKSNLTMEDVSPGTSQMRARRHKRETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLI
EIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDN
AQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDT
LERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAF
GGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDAVCAHGQCCEDCQLKPPGTAC
RGSSNSCDLPEFCTGTAPHCPANVYLHDGHPCQGVDGYCYNGICQTHEQQCVTLWGPGAK
PAPGICFERVNSAGDPYGNCGKDSKSAFAKCELRDAKCGKIQCQGGASRPVIGTNAVSIE
TNIPQQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCAEGKICLNRRCQNISVFGVHKCAM
QCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQGLTVGILVSILCLLA
AGFVVYLKRKTLMRLLFTHKKTTMEKLRCVHPSRTPSGPHLGQAHHTPGKGLLMNRAPHF
NTPKDRHSLKCQNMDISRPLDARAVPQLQSPQRVLLPLHQTPRAPSGPARPLPASPAVRQ
AQGIRKPSPPQKPLPADPLSRTSRLTSALVRTPGQQEPGHRPAPIRPAPKHQVPRPSHNA
YIK
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcgcccggcgcggcgcgcgccccccgcccgcgccctcctgctggccctggct
ggggccctgctggcgccccgtgcagcccgagggatgagtttgtgggaccagagaggaact
tacgaagtggccagagcctcccttctgagcaaggaccctgggatcccaggacagagcatc
ccagccaaggatcatccagacgtgctgactgtgcaactgcagctggagagccgagacctg
atcctcagcctggaaaggaatgagggactcattgccaatggcttcacggagacccattat
ctgcaagatggtactgatgtctctctcactcgaaatcacacggatcattgttactaccat
ggacatgtgcaaggagatgctgcatcagtggtcagcctcagtacttgctctggtctccgg
ggacttatcatgtttgaaaataaaacgtacagcttagagccaatgaaaaacaccactgac
agctacaaactcgtcccagctgagagcatgacgaacatccaagggctgtgtgggtcacag
cataacaagtccaacctcaccatggaagatgtctcccctggaacctctcaaatgcgggca
agaaggcataagagagagacccttaagatgaccaagtacgtagagctggttattgtggca
gacaacagagagtttcagaggcaaggaaaagacctggagaaagttaagcagcgattaata
gagatcgccaatcacgttgacaagttttacagaccactgaacatccggatcgtgctggta
ggagtggaagtgtggaatgacatcgacaaatgctctataagccaggacccattcaccagc
ctccatgagtttctagactggagaaagataaagcttctacctcgaaaatcccacgacaat
gctcagcttatcagtggggtttatttccaaggaaccaccatcggcatggcacccatcatg
agcatgtgcactgcagaacagtctggaggagttgtcatggaccattcagacagccccctt
ggtgccgcagtgaccttggcacatgagctgggccacaacttcgggatgaaccatgacaca
ctggagaggggctgcagctgcagaatggccgcagagaaaggaggctgcatcatgaacccg
tccacggggttcccattccccatggtgttcagcagctgcagcaggaaggacctggaggct
agcctggagaagggcatggggatgtgcctcttcaacctaccagaggtcaagcaggccttt
gggggccggaagtgtggaaatggctatgtggaagagggagaagagtgtgactgcggagaa
ccggaggaatgcacgaatcgctgctgtaacgctaccacctgtactctgaagccagatgct
gtgtgcgcgcacgggcagtgctgtgaagactgtcagctgaagcctccaggaactgcatgc
aggggctccagcaactcctgtgacctcccagaattctgcacagggactgcccctcactgt
ccagccaatgtgtacctacatgatggccacccgtgtcagggcgtggatggttactgctac
aacggcatctgccagacccatgagcagcagtgtgtcacgctctggggaccaggtgctaaa
ccggctcctggcatctgctttgagcgagtcaactctgcaggagatccttatggtaactgt
ggcaaagactccaagagcgccttcgccaaatgtgagctgagagatgccaagtgtgggaaa
atccagtgtcaaggtggtgcaagccgacctgtcattggtaccaatgctgtttccatagaa
acaaatatcccacagcaggaaggaggtcggattctgtgccgggggacccatgtgtacttg
ggtgatgacatgccagacccagggcttgtgcttgcaggaacaaagtgtgcagaaggaaaa
atctgcctcaatcgtcgatgtcagaatatcagtgtcttcggcgttcacaagtgtgccatg
cagtgccacggccgaggggtatgtaacaacaggaagaattgccactgtgaagcccactgg
gctccacccttctgtgacaagtttggctttggaggaagcacagacagtggtcccatcagg
caagcagataaccagggcttgactgtaggaatcctggtgagcatcctgtgtctgcttgct
gctggatttgtggtgtatctcaaaaggaagacgttgatgcggctgctgttcacacataaa
aaaaccaccatggaaaagctaaggtgtgtgcacccttcccggacacccagtggccctcac
cttggccaggctcaccacacccccgggaaaggcctgctgatgaaccgggcaccacatttc
aatacccccaaggacaggcactcgctgaaatgccagaacatggacatcagcaggcccctc
gacgctcgagccgtcccacagcttcagtcacctcagcgagtgctcctgcctctccaccag
accccacgtgcacccagtggccctgccaggcccctgcccgccagtcctgcagtcaggcag
gcccagggcattcgaaaacccagtcctcctcagaagcctctgcctgctgatccactgagc
aggacttctcggctcactagtgccttggtgaggaccccagggcagcaggaacctgggcac
cgcccagcccccatcagacctgcccctaagcatcaagtacccagaccttcccacaatgcc
tatatcaagtga

DBGET integrated database retrieval system