KEGG   Mus musculus (mouse): 11490
Entry
11490             CDS       T01002                                 

Gene name
Adam15, AD56, MDC15, metar
Definition
(RefSeq) a disintegrin and metallopeptidase domain 15 (metargidin)
  KO
K06836  disintegrin and metalloproteinase domain-containing protein 15 [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    11490 (Adam15)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     11490 (Adam15)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   11490 (Adam15)
SSDB
Motif
Pfam: Reprolysin ADAM_CR Disintegrin Reprolysin_5 Pep_M12B_propep Reprolysin_3 Reprolysin_2 Reprolysin_4 CD20 Peptidase_M10 DUF4953
Other DBs
NCBI-GeneID: 11490
NCBI-ProteinID: NP_001032811
MGI: 1333882
Ensembl: ENSMUSG00000028041
Vega: OTTMUSG00000022081
UniProt: O88839
Position
3 F1; 3 39.07 cM
AA seq 864 aa
MRLALLWALGLLGAGSPRPSPPLPNIGGTEEEQQASPERTLSGSMESRVVQDSPPMSLAD
VLQTGLPEALRISLELDSESHVLELLQNRDLIPGRPTLVWYQPDGTRMVSEGYSLENCCY
RGRVQGHPSSWVSLCACSGIRGLIVLSPERGYTLELGPGDLQRPVISRIQDHLLLGHTCA
PSWHASVPTRAGPDLLLEQHHAHRLKRDVVTETKIVELVIVADNSEVRKYPDFQQLLNRT
LEAALLLDTFFQPLNVRVALVGLEAWTQHNLIEMSSNPAVLLDNFLRWRRTDLLPRLPHD
SAQLVTVTSFSGPMVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHD
SPGHSCPCPGPAPAKSCIMEASTDFLPGLNFSNCSRQALEKALLEGMGSCLFERQPSLAP
MSSLCGNMFVDPGEQCDCGFPDECTDPCCDHFTCQLRPGAQCASDGPCCQNCKLHPAGWL
CRPPTDDCDLPEFCPGDSSQCPSDIRLGDGEPCASGEAVCMHGRCASYARQCQSLWGPGA
QPAAPLCLQTANTRGNAFGSCGRSPGGSYMPCAPRDVMCGQLQCQWGRSQPLLGSVQDRL
SEVLEANGTQLNCSWVDLDLGNDVAQPLLALPGTACGPGLVCIGHRCQPVDLLGAQECRR
KCHGHGVCDSSGHCRCEEGWAPPDCMTQLKATSSLTTGLLLSLLLLLVLVLLGASYWHRA
RLHQRLCQLKGSSCQYRAPQSCPPERPGPPQRAQQMTGTKQASVVSFPVPPSRPLPPNPV
PKKLQAALADRSNPPTRPLPADPVVRRPKSQGPTKPPPPRKPLPANPQGQHPPGDLPGPG
DGSLPLVVPSRPAPPPPAASSLYL
NT seq 2595 nt   +upstreamnt  +downstreamnt
atgcggctggcgctgctctgggctctgggactcctgggcgcgggcagccctcggccctcc
ccgccgctgccaaatataggaggcactgaggaagagcagcaagccagcccagagaggacg
ctgagtggatccatggagagccgggttgttcaggacagccccccaatgagcctagcagac
gtgcttcagactggtttacctgaggccctgaggatttccttggagctggacagtgagagt
catgtcctggagcttctacaaaatagagatctaatccctggccgcccaactctggtgtgg
taccagcctgatggcacccgaatggtcagcgagggctacagtctagaaaactgctgctac
cgaggacgagtgcagggccaccccagctcctgggtgtccctctgtgcctgctctgggatc
agggggctcattgtcctgtccccagagagaggctatacactggagctgggccctggggac
cttcagcgtcctgtcatttctcggatccaagaccacctgttgctgggccacacctgtgcc
ccaagctggcatgcctctgtgcccactcgggcaggaccagacctccttctggaacagcat
cacgctcacaggcttaagcgagatgtagtaacagagacgaaaattgtggagttggtgatt
gtggctgataattcagaggtcagaaagtaccctgacttccaacaactgctgaaccggaca
ctagaagcggctctcttgctagacacgttcttccagcccttgaatgtccgggtagccctt
gtgggcctagaggcatggacccagcacaacctgatagaaatgagctccaacccagctgtc
ctgctagacaacttcctccgctggcgccggacagacttgctgcctcgactgccccatgac
agtgcccaactggtgactgtaacttccttctctggtcccatggtgggcatggccattcag
aattccatctgttcccctgacttctccggaggtgtgaatatggaccactccacaagcatc
ttaggcgttgcctcctcgattgcccatgaattgggccacagtctgggtttggaccatgat
tctcccgggcacagctgtccctgtccaggtccagccccggctaagagctgcatcatggag
gcctccacagacttcctaccaggtttgaacttcagcaactgcagccgacaggccctggaa
aaggccctcctggaaggaatgggcagctgcctcttcgaacggcaacccagcctggcccct
atgtcctctttgtgtggaaatatgtttgtggaccccggagagcagtgtgactgtggcttc
ccagatgaatgcactgatccctgctgtgaccatttcacctgccagctgaggccaggagcg
cagtgtgcatctgatggaccctgttgtcaaaactgcaagttgcacccagctggttggctg
tgccgccctcccacagacgattgtgatctgcctgagttctgcccaggagatagctctcag
tgcccgtctgacatcagacttggggacggtgagccttgtgctagtggagaggctgtgtgt
atgcatgggcgctgtgcctcctatgcccggcagtgccagtcactttggggacccggggcc
cagcctgctgcgccactttgcctccaaacagccaacactcggggtaatgcctttgggagc
tgtgggcgcagccctggtggtagctacatgccttgtgcccctagagatgtcatgtgtggg
caactgcagtgccagtggggtaggagccagcctctgttgggctcagtccaagatcggctc
tcggaggtcctggaagccaacgggacacagttaaactgcagctgggtggacctggacctg
ggcaatgatgtggcccagcctcttctggctctgcctggcactgcctgtggtcctggcctg
gtgtgcatcggccaccgatgccagcccgtggatctcctgggagcacaggaatgtcgaaga
aaatgccacggccatggggtctgtgacagcagcgggcactgccgctgtgaagagggctgg
gcacctccagactgcatgacccagctcaaagcaaccagctccctgaccacaggcctgctc
ctcagcctcctgttgttattggtcctcgtactacttggtgccagctactggcaccgtgcc
cgcctgcatcagcggctctgccagcttaagggatccagctgccaatatagggcaccccaa
tcctgtcctcctgaacgaccaggacctccacagcgggcacagcagatgacaggcactaag
caagctagtgtggtcagctttccagtgcccccctccaggccgctgccacctaaccccgtg
cccaagaaactccaggctgcgctggctgaccgatccaatccccccactcgccctctgccc
gctgaccctgtggtgaggcgcccaaagtctcaggggcctaccaaacccccacccccaaga
aagccactgcctgccaacccacagggccagcacccaccaggtgacctgcctggcccagga
gatggaagcttgccgctggtggtgccctccaggccagctccaccaccccctgcagcatct
tcgctctacctctga

DBGET integrated database retrieval system