KEGG   Mus musculus (mouse): 11491
Entry
11491             CDS       T01002                                 

Gene name
Adam17, CD156b, Tac, Tace
Definition
(RefSeq) a disintegrin and metallopeptidase domain 17
  KO
K06059  disintegrin and metalloproteinase domain-containing protein 17 [EC:3.4.24.86]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu05010  Alzheimer disease
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    11491 (Adam17)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    11491 (Adam17)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11491 (Adam17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    11491 (Adam17)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    11491 (Adam17)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.86  ADAM 17 endopeptidase
     11491 (Adam17)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   11491 (Adam17)
CD molecules [BR:mmu04090]
 Proteins
  11491 (Adam17)
SSDB
Motif
Pfam: Reprolysin_5 Reprolysin_2 ADAM17_MPD Disintegrin Reprolysin_3 Reprolysin Pep_M12B_propep Reprolysin_4
Other DBs
NCBI-GeneID: 11491
NCBI-ProteinID: NP_033745
MGI: 1096335
Ensembl: ENSMUSG00000052593
Vega: OTTMUSG00000021042
UniProt: Q9Z0F8
Position
12 A1.3; 12 8.3 cM
AA seq 827 aa
MRRRLLILTTLVPFVLAPRPPEEAGSGSHPRLEKLDSLLSDYDILSLANIQQHSIRKRDL
QSATHLETLLTFSALKRHFKLYLTSSTERFSQNLRVVVVDGKEESEYSVKWQNFFSGHVV
GEPDSRVLAHIGDDDVTVRINTDGAEYNVEPLWRFVNDTKDKRMLVYKSEDIKDFSRLQS
PKVCGYLNADSEELLPKGLIDREPSEEFVRRVKRRAEPNPLKNTCKLLVVADHRFYKYMG
RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGVQIEQIRILKSPQEVKPGERHFNM
AKSFPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS
HGGVCPKAYYNPTVKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN
SRVDEGEECDPGIMYLNNDTCCNSDCTLKPGVQCSDRNSPCCKNCQFETAQKKCQEAINA
TCKGVSYCTGNSSECPPPGDAEDDTVCLDLGKCKAGKCIPFCKREQELESCACVDTDNSC
KVCCRNLSGPCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS
INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHHSNIEMLSSMD
SASVRIIKPFPAPQTPGRLQALQPAAMMPPVPAAPKLDHQRMDTIQEDPSTDSHADDDGF
EKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQSRVDSKETEC
NT seq 2484 nt   +upstreamnt  +downstreamnt
atgaggcggcgtctcctcatcctgaccactttggtgcctttcgtcctggcaccccgacct
ccggaggaagcaggctctggctcccatccgcgacttgagaagcttgattctttgctctca
gactacgacatcctctccttagctaatattcagcagcactccataaggaaaagggatcta
cagtctgcgacacacttagaaacattactaactttttcagctttgaaaagacattttaaa
ttatacttgacatcaagtaccgaacgcttttcacaaaacttgagagtcgtggtggtggac
gggaaagaagaaagcgagtacagcgtgaagtggcagaacttcttcagtggtcacgtggtt
ggtgagcctgactctagggttctagcccacataggagatgatgatgttacagtgagaatc
aacacagatggggcagaatataacgtagagccactttggaggtttgtcaatgatactaaa
gataaacgaatgctggtgtataagtctgaagatatcaaggatttttcacgtttgcagtct
ccaaaagtatgtggttatttaaatgcagatagtgaagagctgcttccaaaagggctcata
gacagagagccatctgaagagtttgttcgtcgagtgaagagacgagctgaacctaacccc
ttgaagaatacttgtaaattactggtggtagcagatcatcgattttataaatacatgggc
cgtggagaagagagcaccactacaaattacttaatagagctaattgaccgagttgatgac
atataccggaacacgtcgtgggataatgcagggtttaaagggtatggagtgcagatagag
cagattcgaattctcaagtctccacaagaggtaaaacctggtgaaagacacttcaatatg
gcaaaaagtttcccaaacgaagagaaggatgcttgggatgtgaagatgctattagagcaa
tttagctttgatatagctgaagaagcatctaaagtctgcctggctcatcttttcacgtac
caggattttgatatgggaactcttggattagcttacgttggttctcccagagcaaacagt
catggaggggtttgtccaaaagcttattacaacccaactgtgaagaaaaacatctattta
aatagtggtctgactagtactaaaaattatggcaaaactattctcacaaaggaagctgac
ctggttacaactcatgaattgggacataattttggagcagaacatgaccctgatgggcta
gcagaatgtgccccaaatgaggaccaaggaggaaagtatgtcatgtatcccatagctgtg
agcggtgaccacgagaataataagatgttttcaaactgcagtaaacagtccatctacaag
accatagaaagtaaggctcaagagtgcttccaggagcgcagcaacaaggtgtgtggcaac
tccagggtggatgaaggagaggagtgtgacccgggtattatgtacctgaacaacgacacc
tgctgcaatagtgactgcacactgaagccgggtgtgcagtgcagtgataggaacagtcct
tgctgtaaaaactgtcagtttgagacggcgcagaagaagtgccaggaggctattaatgct
acatgcaaaggagtgtcttactgcacagggaatagcagtgagtgccccccacccggagat
gctgaagatgacactgtgtgcttggaccttggcaagtgcaaggctgggaaatgcatccct
ttctgcaagagggagcaggagctggagtcctgcgcatgcgttgacactgacaactcgtgc
aaggtgtgctgcaggaacctttctggcccgtgtgtgccgtacgtcgatgcagagcaaaag
aacttgtttttgaggaaagggaagccatgtacagtagggttttgcgacatgaatggcaaa
tgtgagaaacgagtacaggacgtaattgagcgattttgggatttcattgaccagctgagc
atcaacacttttgggaagtttctggcagataacatcgttgggtctgttctggttttctcc
ttgatattttggattcctttcagcattcttgtccactgtgtggataagaaactggacaag
cagtatgaatccctgtctctgtttcatcacagtaacattgagatgctgagcagcatggac
tcagcatctgttcgcatcatcaagccctttcctgcaccccagactccaggtcgtctgcag
gccctgcagccagctgccatgatgccgccagtacctgcagctccaaaactggaccaccag
aggatggacaccatccaggaagaccccagcacagactcacatgcagatgatgacggtttt
gagaaggaccccttccccaacagcagcacagctgccaagtcctttgaggatctcacagac
cacccagtcaccaggagcgaaaaggcggcctcattcaagctgcagcgtcagagccgagtt
gacagcaaagagacagagtgctag

DBGET integrated database retrieval system