KEGG   Mus musculus (mouse): 11492Help
Entry
11492             CDS       T01002                                 

Gene name
Adam19, AL024287, MADDAM, MTLNB, Mltnb
Definition
(RefSeq) a disintegrin and metallopeptidase domain 19 (meltrin beta)
  KO
K08608  disintegrin and metalloproteinase domain-containing protein 19 [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    11492 (Adam19)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     11492 (Adam19)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   11492 (Adam19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin ADAM_CR Pep_M12B_propep Reprolysin_5 Disintegrin Reprolysin_3 Reprolysin_2 Reprolysin_4 EGF_2 ADAM_CR_2 Zincin_1 Peptidase_M10 Peptidase_M54
Motif
Other DBs
NCBI-GeneID: 11492
NCBI-ProteinID: NP_033746
MGI: 105377
Ensembl: ENSMUSG00000011256
Vega: OTTMUSG00000005488
UniProt: O35674 Q3UHT3
Position
11 B1.1; 11 27.54 cM
AA seq 920 aa AA seqDB search
MPGRAGVARFCLLALALQLHWPLAACEPGWTTRGSQEGSPPLQHELIIPQWRTSESPGRG
KHPLRAELRVMAEGRELILDLEKNEHLFAPAYTETCYTASGNPQTSTLKSEDHCFYHGTV
RDVDESSVTLSTCRGIRGLIIVRSNLSYIIEPVPNSDSQHRIYRSEHLTLPPGNCGFEHS
GPTSKDWALQFTHQTKKQPRRMKREDLHSMKYVELYLVADYAEFQKNRHDQDATKRKLME
IANYVDKFYRSLNIRIALVGLEVWTHGDKCEVSENPYSTLWSFLSWRRKLLAQKSHDNAQ
LITGRSFQGTTIGLAPLMAMCSVYQSGGVSMDHSENAIGVASTVAHEIGHNFGMSHDSAH
CCSASAADGGCIMAAATGHPFPKVFSWCNRKELDRYLQTGGGMCLSNMPDTRTLYGGRRC
GNGYLEDGEECDCGEEEECKNPCCNASNCTLKEGAECAHGSCCHQCKLVAPGTQCREQVR
QCDLPEFCTGKSPHCPTNYYQMDGTPCEGGQAYCYNGMCLTYQEQCQQLWGPGARPALDL
CFERVNAAGDTYGNCGKGLNGQYRKCSPRDAKCGKIQCQSTQARPLESNAVSIDTTITLN
GRRIHCRGTHVYRGPEEEEGEGDMLDPGLVMTGTKCGHNHICFEGQCRNTSFFETEGCGK
KCNGHGVCNNNKNCHCFPGWSPPFCNTPGDGGSVDSGPLPPKSVGPVIAGVFSALFVLAV
LVLLCHCYRQSHKLGKPSALPFKLRHQFSCPFRVSQSGGTGHANPTFKLQTPQGKRKVTN
TPESLRKPSHPPPRPPPDYLRVESPPAPLPAHLNRAAGSSPEAGARIERKESARRPPPSR
PMPPAPNCLLSQDFSRPRPPQKALPANPVPGQRTGPRSGGTSLLQPPTSGPQPPRPPAVP
VPKLPEYRSQRVGAIISSKI
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgcccgggcgcgcgggcgtcgcccggttctgcttgctggctctcgctctgcagctacat
tggccgctggcggcgtgcgagccgggatggaccacaagaggaagccaagaaggtagccct
ccgctacagcatgaactcataatacctcagtggcggacttcagaaagccctgggagagga
aagcatccactcagagcagagctcagggtcatggctgaagggcgagagctgatcctagac
ctggagaagaacgagcacctttttgctccagcctacacagaaacctgctacactgcaagt
ggcaatcctcaaaccagcacgctgaagtctgaggatcactgcttttaccacgggactgtg
agggacgtggatgagtccagtgtcacgctcagcacctgccggggaattagaggactgatt
atagtgagaagtaacctcagctacatcatcgagcccgtccctaacagcgacagccaacac
cgtatttacagatccgaacatctcacgctgcccccggggaactgtgggttcgagcactcc
gggcccacctcgaaggactgggcccttcagtttacacatcagaccaaaaagcaacctcgc
agaatgaaacgggaagatctacactctatgaagtacgtggagctttacctggtggctgat
tatgcagagtttcagaagaatcgacatgaccaggatgccaccaaacgcaagctcatggag
attgccaactatgttgataagttttaccgctccctgaacatccgaattgcacttgtcggc
ttggaggtgtggacgcatggggataagtgtgaagtttcagagaatccctactctaccctc
tggtcctttcttagttggaggcgcaagctgcttgctcagaagagccatgacaatgctcag
ctaatcacgggcaggtccttccaaggcaccaccattggcctggcccccctcatggccatg
tgctccgtgtaccagtctggaggagttagcatggaccactccgagaatgccattggtgta
gcctccactgtggcccatgagattggccacaactttggcatgagccatgattctgcacac
tgctgttctgccagtgcagccgatggcggctgcatcatggccgccgccaccgggcaccct
ttccccaaagtgttcagttggtgtaacaggaaggagctggacaggtatctgcagacagga
ggagggatgtgtctctccaacatgccggacactaggacgctgtatggaggccggaggtgt
ggcaacgggtacctggaagacggtgaagaatgtgactgtggagaagaggaggaatgtaag
aacccttgctgcaatgcctccaactgcactctgaaggaaggggcagagtgtgcccatggt
tcctgctgccaccagtgcaagctggtggctcctggaacccagtgtcgggagcaggttcgg
caatgtgacctccccgagttctgcaccggcaagtctccccactgccccaccaactattat
cagatggatggcaccccctgcgagggtggccaggcctactgctacaacggcatgtgcctc
acttaccaggaacagtgccagcagctgtggggacctggagcccggcctgccctcgatctt
tgctttgagagggtgaatgctgctggtgacacctatggaaactgtggcaagggcttgaat
ggccaatacaggaagtgcagtcccagggatgccaagtgtgggaagattcagtgccagagc
acccaggcccggcccctggaatccaacgcagtatctattgacaccaccatcaccttgaac
gggaggcggatccactgtcggggcacccacgtctaccggggtcctgaggaggaggaaggg
gaaggtgacatgctggacccagggctggtgatgactggaaccaagtgtggccacaaccat
atttgcttcgaggggcagtgcaggaacacctccttctttgagacggaaggctgtgggaaa
aagtgcaatggccacggggtctgcaacaacaacaagaactgtcattgcttccctggctgg
tctccacctttctgtaacaccccgggagatggtggcagcgtcgacagtggtcctttgccc
cctaagagtgtgggtcccgtgatcgctggggtgttttcagctctcttcgtgttggcagtt
ctggtgctactgtgtcactgctacagacagagccacaaactgggcaaaccctcggctctc
cctttcaagctgcggcatcagttcagttgtcccttcagggtatctcagagtggtggaact
ggccatgccaacccaactttcaagttgcagaccccccagggcaagcgaaaggtgactaac
acccctgaatccctccggaagccgtcccacccccctccccggccccctccagactacctg
cgcgttgaatcgccacctgcaccattgccggcacatctgaacagggctgctgggagctcc
ccagaagctggggctcgaatagaaagaaaggagtcagccaggaggcctcccccaagccga
cccatgccccctgcacctaactgcctactgtcccaggacttctccaggcctcgaccacct
cagaaggcactcccagccaatccggtgccaggccaaaggaccggtcccaggtcaggaggc
acctccctgcttcagccccctacttctggtcctcagccccccaggcctccagcagtgcct
gttccaaagctacccgagtaccgatcacagagggttggagcaataattagctccaagatc
tag

DBGET integrated database retrieval system