KEGG   Mus musculus (mouse): 11496Help
Entry
11496             CDS       T01002                                 

Gene name
Adam22, 2900022I03Rik, AI854032, MDC2
Definition
(RefSeq) a disintegrin and metallopeptidase domain 22
  KO
K16068  disintegrin and metalloproteinase domain-containing protein 22 [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    11496 (Adam22)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     11496 (Adam22)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   11496 (Adam22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin Pep_M12B_propep ADAM_CR Disintegrin Reprolysin_3 EGF_2 Reprolysin_2
Motif
Other DBs
NCBI-GeneID: 11496
NCBI-ProteinID: NP_001297369
MGI: 1340046
Ensembl: ENSMUSG00000040537
Vega: OTTMUSG00000016341
UniProt: Q9R1V6 D6QSS8
Position
5 A1; 5 3.39 cM
AA seq 904 aa AA seqDB search
MQAAAAASFWLLCVLGTCPLARCGRAGVASLKGLERGKENRFLERQSIIPLRLIYRLGGE
DETQHNQLDTRVRGDPGGPQLTHVDKASFRVDAFGTSFVLDVLLNHELLSSGYVERQIEH
GGKVVENKGGEHCYYQGQIRGNPVSFVALSTCHGLHGMFYDGNHTYLIEPEENEKSQESS
HCHSVYKSRQFEFPLDDLPSEFQRVNITPPQFILKPRLKRRKRQLLRFPRNVEEETKYIE
LMIVNDHLMFKKHRLSVVYTNTYAKSVVNMADVIYKDQLKTRIVLVAMETWAADNKFAIS
ENPLITLREFMKYRRDFIKEKADAVHLFSGSQFESSRSGAAYIGGICSLLRGGGVNEFGK
TDLMAVTLAQSLAHNVGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNVEEY
HDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECALEGAECCKKCTLTQD
SQCSDGLCCKKCKFQPLGTVCREAVNDCDIREICSGNSSQCAPNVHKMDGYSCDGTQGIC
FGGRCKTRDRQCKYIWGQKVTASDRYCYEKLNIEGTEKGNCGKDKDTWTQCNKRDVLCGY
LLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGAHVKLEEDVDLGYVEDGTPCGPQMM
CLEHRCLPVASFNFSTCSSSKAGTVCSGNGVCSNELKCVCNRHWTGADCGTHFPHNDDAK
TGITLSGNGVAGTNIIIGIIAGTILVLALILGITAWGYKNYREQRQLPQGDYVKKPGDGD
SFYSDFPPGGSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNMGGN
KKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEGKTAGRQSARLW
ETSI
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagcggcggccgcgtccttctggctgctctgcgtcttggggacctgccccctg
gcgcgctgcggtcgggcaggagtcgcctcactgaaaggactggagagggggaaagaaaac
cgcttcctggagcgccagagcatcataccactgcgcctcatctatcgcttgggcggcgag
gatgaaactcagcacaaccagctcgacacgcgggtgcggggcgaccctggcggaccgcag
ctgacgcatgtggacaaggcaagcttccgggtggacgcctttggaacctctttcgttctc
gacgtcctgctgaaccacgagttgctgtcgtcaggttatgtagagagacagattgaacat
ggaggcaaggtcgtggagaacaaaggaggagaacactgttattaccagggccagattcga
ggaaaccctgtctcatttgttgccctatcaacatgccatggactccatgggatgttctat
gatggaaaccacacatatctcattgagccagaagaaaatgagaagtctcaagagtcgtct
cattgtcactccgtgtacaaatccagacagtttgaatttcccttggatgaccttccgtct
gaatttcaacgcgtaaacattactccccctcagtttattttgaagccaagactaaagagg
agaaaaagacagcttcttcgatttcctcggaatgtagaggaggaaaccaaatacatcgaa
ctgatgattgtgaatgatcatctcatgtttaaaaagcaccggctttctgttgtatatact
aatacctatgcgaagtctgtggtgaacatggcagatgtgatctataaagaccaactgaaa
actaggattgtattggttgccatggaaacctgggctgctgacaacaagtttgccatatct
gaaaacccactgattacccttcgtgagttcatgaaatacaggagggattttatcaaggag
aaggctgatgcagttcatcttttctcgggcagtcaatttgagagtagccggagcggggca
gcttatattggtgggatttgctcgctgctgagaggaggaggcgtgaatgaatttggaaaa
acggatttaatggcagttaccctcgctcagtcactagcccacaatgtcggtataatctct
gacaaaagaaaactagcaagtggtgagtgtaaatgtgaggacacctggtccgggtgcata
atgggagacaccggctactatctcccgaaaaagttcactcagtgcaatgtcgaggaatat
catgacttcctgaatagtggtggaggtgcctgcctgttcaacaagccttccaagcttctt
gatcctcctgagtgtggaaacggcttcattgaaaccggagaggagtgtgattgtggcacc
cctgcagaatgtgcccttgaaggggcagagtgttgtaagaaatgcaccttgacccaggat
tctcaatgcagtgatggcctttgttgtaaaaagtgcaagtttcagcctctggggaccgtg
tgccgagaggcagtgaacgactgtgacattcgtgaaatatgttcaggaaattcgagccag
tgtgcccccaatgtgcataaaatggatggatattcgtgtgatggtactcagggaatttgc
tttggaggaagatgtaaaaccagagatagacaatgcaaatacatctgggggcaaaaggta
acagcatctgacaggtactgctatgagaaactgaacattgaggggacggagaagggtaac
tgtgggaaagacaaggacacgtggacacagtgcaacaaacgggatgtactttgtggttac
ctcctgtgcacaaacattggcaacatcccaaggctcggggagcttgatggtgagatcaca
tccacattagttgtgcagcaaggaagaacattaaactgcagtggcgcgcatgttaaactt
gaagaagatgtggatcttggctatgtggaagatgggacgccctgtggccctcagatgatg
tgcttggaacacaggtgtcttcctgtggcttccttcaacttcagtacttgctccagcagt
aaagcaggcaccgtgtgctcaggaaatggagtttgcagcaatgagctcaagtgtgtgtgc
aacaggcactggacaggggctgactgcggcacccactttcctcacaatgatgatgcaaag
actggcatcaccctgtctggcaatggtgttgctggcactaatatcataataggaataatt
gccggcaccattttagtgctggccctcatcttaggaataactgcctggggttataaaaac
taccgagaacagagacagttaccccagggagattatgtaaaaaagcctggcgatggcgac
tctttttatagcgactttcctcccggaggcagcacaaactcagcatctagttctaagaag
aggtcaaatggactctctcattcttggagtgaaaggattccagacacaaaacatatttca
gacatctgtgaaaatgggagacctcgcagtaactcctggcaaggtaacatgggaggcaac
aaaaagaaaatcagagggaaaagatttagacctcgatctaactcaactgagaccctgtca
cctgccaagtctccttcttcatcaactgggtctattgcctccagcagaaaatacccgtac
cctatgcctccgcttccagacgaggggaagacagcgggccgacagagcgccaggctatgg
gagacatccatttaa

DBGET integrated database retrieval system