KEGG   Mus musculus (mouse): 11516
Entry
11516             CDS       T01002                                 

Gene name
Adcyap1, P, PACAP
Definition
(RefSeq) adenylate cyclase activating polypeptide 1
  KO
K05262  pituitary adenylate cyclase-activating polypeptide
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04713  Circadian entrainment
mmu04911  Insulin secretion
mmu04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    11516 (Adcyap1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11516 (Adcyap1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    11516 (Adcyap1)
   04924 Renin secretion
    11516 (Adcyap1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    11516 (Adcyap1)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 11516
NCBI-ProteinID: NP_001302432
MGI: 105094
Ensembl: ENSMUSG00000024256
UniProt: O70176 Q3UYH8 Q8BJT8
Position
17; 17 E5
AA seq 175 aa
MTMCSGARLALLVYGIIMHSSVSCSPAAGLSFPGIRPEDEAYDQDGNPLQDFYDWDPPGV
GSPASALRDAYALYYPADRRDVAHEILNEAYRKVLDQLSARKYLQSVVARGAGENLGGSA
VDDPAPLTKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
NT seq 528 nt   +upstreamnt  +downstreamnt
atgaccatgtgtagcggagcaaggctggccctgctggtgtatgggataataatgcatagc
agtgtctcctgttcacctgccgccggactcagcttccctgggatcagaccagaagacgag
gcttacgaccaggacggaaacccgctgcaagacttctatgactgggaccctcccggcgtg
gggagccccgcctccgcgctgcgtgacgcttacgccctttactatccagcggacaggaga
gatgtcgcccacgaaatccttaacgaagcctatcgaaaagtcttggaccagctgtccgcc
aggaagtacctgcagtcggtcgtggccaggggcgcgggggagaacctaggcggcagcgcg
gtggacgacccggcgccccttaccaaacgccactcggacggcatcttcacagatagctac
agccgctaccgaaaacaaatggctgtcaagaaatacttggcggccgtgctagggaaaagg
tataaacagagggttaaaaacaaaggacgccgaatagcatacttgtag

DBGET integrated database retrieval system