KEGG   Mus musculus (mouse): 11517Help
Entry
11517             CDS       T01002                                 

Gene name
Adcyap1r1, 2900024I10Rik, AI846590, PAC1, PAC1R, PACAP1-R
Definition
(RefSeq) adenylate cyclase activating polypeptide 1 receptor 1
  KO
K04587  pituitary adenylate cyclase-activating polypeptide type I receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04713  Circadian entrainment
mmu04911  Insulin secretion
mmu04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    11517 (Adcyap1r1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11517 (Adcyap1r1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    11517 (Adcyap1r1)
   04924 Renin secretion
    11517 (Adcyap1r1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    11517 (Adcyap1r1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    11517 (Adcyap1r1)
G protein-coupled receptors [BR:mmu04030]
 Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide (VIP) and pituitary adenyl cyclase-activating peptide (PACAP)
    11517 (Adcyap1r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 11517
NCBI-ProteinID: NP_031433
MGI: 108449
Ensembl: ENSMUSG00000029778
Vega: OTTMUSG00000035961
UniProt: P70205 Q6NXJ9
Position
6; 6 B3
AA seq 496 aa AA seqDB search
MARTLQLSLTALLLLPMAIAMHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDN
ITCWKPAQIGEMVLVSCPEVFRIFNPDQVWMTETIGDSGFADSNSLEITDMGVVGRNCTE
DGWSEPFPHYFDACGFDDYEPESGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRK
LHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSSHCFVSTVECKAVMVFFHYCVVSN
YFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCVTVWAVLRLYFDDAGCWDMN
DSTALWWVIKGPVVGSIMVNFVLFIGIIIILVQKLQSPDMGGNESSIYFSCVQKCYCKPQ
RAQQHSCKMSELSTITLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQ
GFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFTMDFKHRHPSLASSGVNGGTQLSILSKS
SSQLRMSSLPADNLAT
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggccagaaccctgcagctctccctgactgctctcctcctgctgcctatggctattgct
atgcactctgactgcatcttcaagaaggagcaagccatgtgcctggagaggatccagagg
gccaacgacctgatgggcctaaatgagtcttccccaggttgccctggcatgtgggacaat
atcacatgttggaagcctgctcaaataggtgagatggtccttgtgagctgccctgaggtc
ttccggatcttcaacccggaccaagtctggatgacagaaaccataggggattctggcttt
gctgatagtaattccttggagatcacagacatgggggtcgtgggccggaactgcactgag
gatggctggtcggagcccttcccccattacttcgatgcttgtgggtttgatgactatgag
cccgagtctggggatcaggattattactacctgtcggtgaaggccctctacacagtcggc
tacagcacctccctcgtcaccctcaccactgccatggtcatcttgtgccgcttccggaag
ctgcactgtacccgtaacttcatccacatgaacctgtttgtatccttcatgctgagagct
atctctgtcttcatcaaagactggatcttgtatgccgagcaggacagcagtcattgcttc
gtttccaccgtggaatgcaaagctgtcatggttttctttcactactgcgtggtgtccaac
tacttctggctgttcattgaaggcctatacctctttacactgctggtggagaccttcttc
cctgagaggagatatttctactggtataccatcattggctgggggacacctactgtgtgt
gtaactgtgtgggctgtgctgaggctctactttgatgatgcgggatgctgggatatgaat
gacagcacagctctgtggtgggtgatcaaaggccctgtagttggctctataatggttaac
tttgtgcttttcatcggcatcatcatcatccttgtgcagaagctgcagtccccagacatg
ggaggcaatgagtcgagcatctacttcagctgcgtgcagaaatgctactgcaagccacag
cgggctcagcagcactcttgcaagatgtcagaactatccaccattactctacggctggcc
cgctccaccctgctgctcatcccactctttggaatccactacacagtatttgccttctct
ccagagaacgtcagcaagagggaaagacttgtgtttgagcttgggctgggctccttccag
ggctttgtggtggctgtactctactgcttcctgaatggggaggtacaggcagagattaag
aggaaatggaggagctggaaggtgaaccgttacttcactatggacttcaagcaccggcat
ccatccctggccagcagtggagtgaacgggggcacccagctgtccatcctgagcaagagc
agctcccagctccgcatgtccagcctcccggccgacaacttggccacctga

DBGET integrated database retrieval system