KEGG   Mus musculus (mouse): 11520
Entry
11520             CDS       T01002                                 

Gene name
Plin2, AA407157, ADPH, Adfp, Adrp
Definition
(RefSeq) perilipin 2
  KO
K17284  perilipin-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    11520 (Plin2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11520 (Plin2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   11520 (Plin2)
SSDB
Motif
Pfam: Perilipin SH3BP5 GlutR_dimer
Other DBs
NCBI-GeneID: 11520
NCBI-ProteinID: NP_031434
MGI: 87920
Ensembl: ENSMUSG00000028494
Vega: OTTMUSG00000007453
UniProt: P43883 Q3U711
Position
4 C4; 4 40.69 cM
AA seq 425 aa
MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRSVCEMAEKGVKTVTSA
AMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEIVASARGAVTGAKDVVT
TTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTVLGMVQFMNSGVDNAITK
SELLVDQYFPLTQEELEMEAKKVEGFDMVQKPSNYERLESLSTKLCSRAYHQALSRVKEA
KQKSQETISQLHSTVHLIEFARKNMHSANQKIQGAQDKLYVSWVEWKRSIGYDDTDESHC
VEHIESRTLAIARNLTQQLQTTCQTVLVNAQGLPQNIQDQAKHLGVMAGDIYSVFRNAAS
FKEVSDGVLTSSKGQLQKMKESLDEVMDYFVNNTPLNWLVGPFYPQSTEVNKASLKVQQS
EVKAQ
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggcagcagcagtagtggatccgcaacagagcgtggtgatgagagtggccaacctgccc
ttggtgagctctacctacgaccttgtgtcctccgcttatgtcagtacaaaggatcagtac
ccgtatttgagatccgtgtgtgagatggccgagaagggcgtgaagaccgtgacctctgcg
gccatgacaagtgccctgcccatcatccagaagctggagccacaaattgcggttgccaat
acctatgcctgcaaggggctagacaggatggaggaaagactgcctattctgaaccagcca
acgtccgagattgttgccagtgccagaggtgccgtaactggggcgaaggatgtggtgacg
actaccatggctggagccaaggattctgtagccagcacagtctcaggggtggtggataag
accaaaggagcagtgactggcagcgtggaaaggaccaagtctgtggtcaatggcagcatc
aatacagttttggggatggtgcagttcatgaacagtggagtagataatgccatcaccaag
tcggagctgctggtagaccagtacttccctctcactcaggaggagctggagatggaagca
aaaaaggtggaaggatttgatatggttcagaagccgagcaactatgaacggctggagtcc
ctgtctaccaagctctgctctcgggcttatcaccaggctctcagcagggttaaagaggcc
aaacaaaagagccaggagaccatttctcagctccactccactgtccacctgattgaattc
gccaggaagaatatgcacagtgccaaccagaaaattcagggtgctcaggataagctctat
gtctcgtgggtggagtggaagagaagcatcggctacgacgacaccgatgagtcccactgt
gttgagcacatcgagtcacgtactctggctatcgcccgcaacctgacccagcagctccag
actacatgccagactgtcctggtcaacgcccaagggttaccacagaacattcaagatcag
gccaaacacttgggggtgatggcaggcgacatctactccgtattccgcaatgctgcctcc
tttaaggaagtgtccgatggcgtcctcacatctagcaaggggcagctgcagaaaatgaag
gaatccttagatgaagttatggattactttgttaacaacacgcctctcaactggctggta
ggtcccttttatcctcagtctaccgaggtgaacaaggccagcctgaaggtccagcagtct
gaggtcaaagctcagtaa

DBGET integrated database retrieval system