KEGG   Mus musculus (mouse): 11522
Entry
11522             CDS       T01002                                 

Gene name
Adh1, ADH, ADH-A2, ADH-AA, AI194826, Adh-, Adh-1, Adh-1-, Adh-1-t, Adh-1e, Adh-1t, Adh-3e, Adh1-, Adh1-e, Adh1-t, Adh1tl, Adh3-e
Definition
(RefSeq) alcohol dehydrogenase 1 (class I)
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00071  Fatty acid degradation
mmu00350  Tyrosine metabolism
mmu00620  Pyruvate metabolism
mmu00830  Retinol metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    11522 (Adh1)
   00620 Pyruvate metabolism
    11522 (Adh1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    11522 (Adh1)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    11522 (Adh1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    11522 (Adh1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    11522 (Adh1)
   00982 Drug metabolism - cytochrome P450
    11522 (Adh1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    11522 (Adh1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     11522 (Adh1)
SSDB
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N 2-Hacid_dh_C TrkA_N
Other DBs
NCBI-GeneID: 11522
NCBI-ProteinID: NP_031435
MGI: 87921
Ensembl: ENSMUSG00000074207
Vega: OTTMUSG00000034747
UniProt: P00329 Q3UKA4
Position
3 G3; 3 64.16 cM
AA seq 375 aa
MSTAGKVIKCKAAVLWELHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHVVSGTLVT
PLPAVLGHEGAGIVESVGEGVTCVKPGDKVIPLFSPQCGECRICKHPESNFCSRSDLLMP
RGTLREGTSRFSCKGKQIHNFISTSTFSQYTVVDDIAVAKIDGASPLDKVCLIGCGFSTG
YGSAVKVAKVTPGSTCAVFGLGGVGLSVIIGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYSKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALLSCHAACGVSVVVGVPPNAQ
NLSMNPMLLLLGRTWKGAIFGGFKSKDSVPKLVADFMAKKFPLDPLITHVLPFEKINEAF
DLLRSGKSIRTVLTF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgagcactgcgggaaaagtgatcaaatgcaaagctgcggtgctatgggagcttcacaaa
cccttcaccatcgaggacatagaagtcgcaccccccaaggcccatgaagttcgaattaag
atggtggccactggtgtctgccgctcagacgatcacgtggttagtggaaccctggtcaca
cctcttcctgcagttttaggccatgagggagcaggcattgttgagagcgttggagaaggg
gtgacttgtgtgaaaccaggtgataaagtcattccactcttttcccctcagtgtggagaa
tgcaggatttgcaagcacccggaaagcaacttttgtagccgaagcgatctgctaatgcct
cgggggactttgcgcgaaggcaccagcaggttctcctgcaagggaaagcagatccacaac
tttatcagcaccagcaccttctcccagtacaccgtggtagatgatatagcagtggccaaa
atcgatggagcttcaccactggacaaagtctgcctcatcggctgtgggttctcaactggc
tatggctctgccgtcaaagtcgccaaggtgaccccaggctccacatgtgccgtgtttggc
ctcggaggtgtcggtctgtctgtcatcattggctgtaaagcagcaggagcagccaggatc
attgctgtggacatcaacaaggacaagtttgccaaggccaaagagttgggtgcaactgag
tgcatcaaccctcaagactacagcaaacccatccaggaagttctccaggagatgaccgac
ggaggggtggacttttcgtttgaagtcatcggccgccttgacaccatgacttctgccctg
ctgagctgccatgcagcatgtggtgtaagcgtcgtcgtaggagtgcctcccaatgcccag
aacctctccatgaaccccatgttgctgctgctgggacgcacctggaagggagcaatattt
ggcgggtttaagagtaaagattctgtccctaaacttgtggctgacttcatggctaagaag
tttccgttggacccgttaattacccatgttttacctttcgagaaaataaatgaagcattt
gacctgcttcgttctggaaagagcatccgtaccgtcctgactttctga

KEGG   Mus musculus (mouse): 11529
Entry
11529             CDS       T01002                                 

Gene name
Adh7, AI325182, Adh, Adh-, Adh-3, Adh-3e, Adh-3t, Adh3, Adh3-, Adh3-e, Adh3-t, Adh4, Adt-, Adt-1
Definition
(RefSeq) alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00071  Fatty acid degradation
mmu00350  Tyrosine metabolism
mmu00620  Pyruvate metabolism
mmu00830  Retinol metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    11529 (Adh7)
   00620 Pyruvate metabolism
    11529 (Adh7)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    11529 (Adh7)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    11529 (Adh7)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    11529 (Adh7)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    11529 (Adh7)
   00982 Drug metabolism - cytochrome P450
    11529 (Adh7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    11529 (Adh7)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     11529 (Adh7)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N UDPG_MGDP_dh_N Glu_dehyd_C
Other DBs
NCBI-GeneID: 11529
NCBI-ProteinID: NP_033756
MGI: 87926
Ensembl: ENSMUSG00000055301
Vega: OTTMUSG00000052803
UniProt: Q64437 Q9D748
Position
3 G3; 3 64.13 cM
AA seq 374 aa
MGTAGKVIKCKAAVLWGVNQPFSIEEIEVAPPKAKEVRVKILATGICRTDDHIIKGSMVS
KFPVIVGHEAVGVVESVGEGVTTVRPGDKVIPLFLPQCRECNACLNPEGNLCIRSDLTGR
GVLADGTTRFTCKGKPVQHFMNTSTFTEYTVLDESSVAKVDGAAPPEKACLIGCGFSTGY
GAAVKTAKVTPGSTCVVFGLGGVGLSVIMGCKAAGASRIIGIDINKDKFQKALAVGATEC
ISPKDSTKPISEVLSDMTGNTIQYTFEVIGRLETMVDALSSCHMNYGTSVVVGAPPSAKM
LTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTLPFNNINEGFE
LLYSGKSIRTVLTF
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgggcaccgctggaaaagttattaagtgcaaagcggctgtcctatggggagtgaaccag
cctttctccattgaggaaatcgaggtggccccaccaaaggctaaggaagtccgtgttaag
attttggccacaggaatctgtcgcacagatgaccatataataaaaggatcgatggtgtct
aagtttccagtgattgtgggacatgaagcagttggggttgtggagagtgttggagaaggg
gtcactacagtgagaccaggtgacaaagtcatccccctctttctaccacagtgtagagaa
tgcaacgcctgcctgaacccagagggcaatctctgcattaggagcgatctgacaggccgt
ggagtattggctgatggcactaccagattcacctgcaagggcaaaccggtccagcacttc
atgaacaccagcaccttcactgagtacacggtgctggacgaatcctccgtagcgaaggtt
gacggtgcggctccgcctgagaaagcctgcttgatcggctgtggattttccacgggttat
ggagctgctgttaaaactgccaaggtcacccctggctccacttgtgttgtctttggcctg
ggaggagttggcctgtcagtcatcatgggctgtaaagcagctggtgcctccaggatcatt
ggaatcgacatcaacaaagacaaattccagaaagctctggccgtaggtgccacagagtgt
atcagtcccaaggactctaccaagcccatcagtgaggtgctatccgacatgacaggcaac
accatacagtatacttttgaagttattgggcgtcttgagaccatggttgatgccctctca
tcttgccatatgaactatgggaccagtgtggtggttggtgctcctccgtcagccaagatg
ctcacctatgacccaatgctgctcttcactgggcgtacgtggaagggctgcgtctttgga
gggtggaagagcagagatgatgtacctaaactggtgactgagttcctggaaaagaagttt
gacctggaccagttgataacccacaccttgccttttaataacatcaatgaaggatttgaa
ttgctgtattcggggaaaagcattcggactgtcctgacattttga

KEGG   Mus musculus (mouse): 11532
Entry
11532             CDS       T01002                                 

Gene name
Adh5, Adh, Adh-, Adh-5, Adh3, G, GSNOR
Definition
(RefSeq) alcohol dehydrogenase 5 (class III), chi polypeptide
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00071  Fatty acid degradation
mmu00350  Tyrosine metabolism
mmu00620  Pyruvate metabolism
mmu00830  Retinol metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    11532 (Adh5)
   00620 Pyruvate metabolism
    11532 (Adh5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    11532 (Adh5)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    11532 (Adh5)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    11532 (Adh5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    11532 (Adh5)
   00982 Drug metabolism - cytochrome P450
    11532 (Adh5)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    11532 (Adh5)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     11532 (Adh5)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     11532 (Adh5)
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C UDPG_MGDP_dh_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 11532
NCBI-ProteinID: NP_031436
MGI: 87929
Ensembl: ENSMUSG00000028138
Vega: OTTMUSG00000029527
UniProt: P28474 Q6P5I3
Position
3; 3 G3
AA seq 374 aa
MANQVIRCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKILATAVCHTDAYTLSGADPEGC
FPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGK
GLMPDGTSRFTCKGKSVFHFMGTSTFSEYTVVADISVAKIDPSAPLDKVCLLGCGISTGY
GAAVNTAKVEPGSTCAVFGLGGVGLAVIMGCKVAGASRIIGIDINKDKFAKAKEFGASEC
ISPQDFSKSIQEVLVEMTDGGVDYSFECIGNVKVMRSALEAAHKGWGVSVVVGVAASGEE
ISTRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTGNLSFDQINQAFD
LMHSGDSIRTVLKM
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcgaaccaggtgatcaggtgtaaggctgcagtcgcctgggaggcgggaaagcctctc
tccatagaggagatagaagtggcccctccaaaggctcatgaagttcggattaagatcctt
gccactgctgtttgccacaccgatgcctataccctgagcggagctgaccccgaggggtgt
ttcccagtgatcttgggacatgaaggtgctggaattgtggaaagtgttggtgaaggggtc
acgaagctgaaggcaggtgacactgtcatcccactctacatcccacagtgtggagaatgc
aagttttgtctgaatcctaaaacaaacctttgccagaaaataagggtcactcaggggaag
ggattaatgccagatgggactagcagatttacctgcaaaggaaagtctgtttttcacttc
atggggactagcacattttccgagtacacagttgtggctgacatctctgttgctaaaatc
gatccttcggcccctttggataaagtctgccttctcggctgtggtatttcaactggctac
ggggctgctgtgaacactgccaaggtggagcctggttctacttgtgccgtctttggcctg
ggaggagttggactggcagtgatcatgggctgtaaggtggctggtgcatcccggatcatt
ggtatcgacatcaataaagataaattcgcaaaggccaaagaatttggagcctctgaatgt
attagcccccaagacttcagtaaatccatccaggaagtcctcgttgagatgacagatggg
ggcgtggattactcctttgagtgcattggcaacgtgaaggtcatgagatcagcccttgag
gcagcccacaaaggctggggtgtcagtgtggtagtgggagtagctgcttcaggggaagaa
atctccactcgtccattccagctggtgacaggacgcacatggaaaggcaccgcctttgga
ggatggaagagtgtggagagtgtcccaaagctggtgtctgaatatatgtccaaaaagata
aaagttgacgaatttgtgaccggcaatctctccttcgaccaaattaaccaagcctttgat
ctgatgcactcgggagacagcattcgaactgttctaaagatgtaa

KEGG   Mus musculus (mouse): 26876
Entry
26876             CDS       T01002                                 

Gene name
Adh4, Adh, Adh2
Definition
(RefSeq) alcohol dehydrogenase 4 (class II), pi polypeptide
  KO
K13980  alcohol dehydrogenase 4 [EC:1.1.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00071  Fatty acid degradation
mmu00350  Tyrosine metabolism
mmu00620  Pyruvate metabolism
mmu00830  Retinol metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    26876 (Adh4)
   00620 Pyruvate metabolism
    26876 (Adh4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    26876 (Adh4)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    26876 (Adh4)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    26876 (Adh4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    26876 (Adh4)
   00982 Drug metabolism - cytochrome P450
    26876 (Adh4)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    26876 (Adh4)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     26876 (Adh4)
SSDB
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 26876
NCBI-ProteinID: NP_036126
MGI: 1349472
Ensembl: ENSMUSG00000037797
Vega: OTTMUSG00000030507
UniProt: Q9QYY9
Structure
PDB: 
1E3I 1E3E 1E3L

Position
3; 3 G3
AA seq 377 aa
MGTQGKVIKCKAAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCPTDINATDPKKKA
LFPVVLGHECAGIVESVGPGVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLRNFKY
PTIDQELMEDRTSRFTCKGRSIYHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCG
FSSGYGAAINTAKVTPSSTCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKAL
GATDCLNPRELDKPVQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGSCTVVGAK
VDKMTIPTVDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVTHALPFESIND
AIDLMKEGKSIRTILTF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgggcacccagggaaaagttattaaatgcaaggcagccattgcctggaaaactggcagt
cccctttgcattgaagaaattgaggtgtcccctcctaaagcttgtgaggttcggattcag
gtaatcgccacgtgtgtgtgccctactgacatcaatgccaccgatcctaagaagaaagct
ctcttcccggtagtccttggtcatgagtgtgcaggaattgtagaaagtgttgggccggga
gtgaccaacttcaaaccaggtgacaaagtaatcccattctttgcaccacagtgcaaaagg
tgcaagctctgtctgagccctctcacaaacctctgtggaaaactccgaaacttcaaatac
cccactattgatcaggagctcatggaagacagaaccagcaggtttacctgcaaaggaaga
tcaatttaccatttcatgggcgtcagttcattctctcaatacactgtggtttcagaggcc
aatcttgccagagtcgatgatgaggcaaacttggagagagtgtgtctgattggatgtggg
ttctcatcaggctacggggctgccatcaatactgccaaggtcacccccagttccacttgt
gctgtctttggcctggggtgtgtaggtctttctgccataattgggtgtaaaatagcaggt
gcttccagaatcatagctattgacatcaacggtgagaagttcccaaaagccaaggccctg
ggagccactgactgcctgaatcccagggagctagacaaacctgtccaggatgtcatcact
gagctgacagctggaggtgtggattactcccttgactgtgcaggaacagctcagaccttg
aaagcagctgtggactgcactgtattaggctgggggtcgtgcactgtggtcggagcaaag
gttgacaaaatgactatacccaccgtggacgttatattgggccgttctataaatggaaca
ttctttggtggttggaaaagtgtagactctgtcccaaacctggtttctgactacaagaat
aagaaattcgatctggacttactggtgacccatgccctacctttcgagagcataaatgat
gccattgacctgatgaaggaaggaaaaagcatccgaacaatcctgaccttctga

DBGET integrated database retrieval system