KEGG   Mus musculus (mouse): 11532Help
Entry
11532             CDS       T01002                                 

Gene name
Adh5, Adh-5, Adh3, GSNOR
Definition
(RefSeq) alcohol dehydrogenase 5 (class III), chi polypeptide
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00071  Fatty acid degradation
mmu00350  Tyrosine metabolism
mmu00830  Retinol metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    11532 (Adh5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    11532 (Adh5)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    11532 (Adh5)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    11532 (Adh5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    11532 (Adh5)
   00982 Drug metabolism - cytochrome P450
    11532 (Adh5)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    11532 (Adh5)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     11532 (Adh5)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     11532 (Adh5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C UDPG_MGDP_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 11532
NCBI-ProteinID: NP_031436
MGI: 87929
Ensembl: ENSMUSG00000028138
Vega: OTTMUSG00000029527
UniProt: P28474 Q6P5I3
Position
3; 3 G3
AA seq 374 aa AA seqDB search
MANQVIRCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKILATAVCHTDAYTLSGADPEGC
FPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGK
GLMPDGTSRFTCKGKSVFHFMGTSTFSEYTVVADISVAKIDPSAPLDKVCLLGCGISTGY
GAAVNTAKVEPGSTCAVFGLGGVGLAVIMGCKVAGASRIIGIDINKDKFAKAKEFGASEC
ISPQDFSKSIQEVLVEMTDGGVDYSFECIGNVKVMRSALEAAHKGWGVSVVVGVAASGEE
ISTRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTGNLSFDQINQAFD
LMHSGDSIRTVLKM
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccaggtgatcaggtgtaaggctgcagtcgcctgggaggcgggaaagcctctc
tccatagaggagatagaagtggcccctccaaaggctcatgaagttcggattaagatcctt
gccactgctgtttgccacaccgatgcctataccctgagcggagctgaccccgaggggtgt
ttcccagtgatcttgggacatgaaggtgctggaattgtggaaagtgttggtgaaggggtc
acgaagctgaaggcaggtgacactgtcatcccactctacatcccacagtgtggagaatgc
aagttttgtctgaatcctaaaacaaacctttgccagaaaataagggtcactcaggggaag
ggattaatgccagatgggactagcagatttacctgcaaaggaaagtctgtttttcacttc
atggggactagcacattttccgagtacacagttgtggctgacatctctgttgctaaaatc
gatccttcggcccctttggataaagtctgccttctcggctgtggtatttcaactggctac
ggggctgctgtgaacactgccaaggtggagcctggttctacttgtgccgtctttggcctg
ggaggagttggactggcagtgatcatgggctgtaaggtggctggtgcatcccggatcatt
ggtatcgacatcaataaagataaattcgcaaaggccaaagaatttggagcctctgaatgt
attagcccccaagacttcagtaaatccatccaggaagtcctcgttgagatgacagatggg
ggcgtggattactcctttgagtgcattggcaacgtgaaggtcatgagatcagcccttgag
gcagcccacaaaggctggggtgtcagtgtggtagtgggagtagctgcttcaggggaagaa
atctccactcgtccattccagctggtgacaggacgcacatggaaaggcaccgcctttgga
ggatggaagagtgtggagagtgtcccaaagctggtgtctgaatatatgtccaaaaagata
aaagttgacgaatttgtgaccggcaatctctccttcgaccaaattaaccaagcctttgat
ctgatgcactcgggagacagcattcgaactgttctaaagatgtaa

DBGET integrated database retrieval system