KEGG   Mus musculus (mouse): 11537
Entry
11537             CDS       T01002                                 

Gene name
Cfd, A, Adn, DF
Definition
(RefSeq) complement factor D (adipsin)
  KO
K01334  complement factor D [EC:3.4.21.46]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    11537 (Cfd)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    11537 (Cfd)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    11537 (Cfd)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    11537 (Cfd)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.46  complement factor D
     11537 (Cfd)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   11537 (Cfd)
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 11537
NCBI-ProteinID: NP_038487
MGI: 87931
Ensembl: ENSMUSG00000061780
UniProt: P03953 Q3UP47
Structure
PDB: 
5FCR

Position
10 C1; 10 39.72 cM
AA seq 259 aa
MHSSVYFVALVILGAAVCAAQPRGRILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQW
VLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFK
LSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTC
NLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYT
RVSSYRMWIENITNGNMTS
NT seq 780 nt   +upstreamnt  +downstreamnt
atgcacagctccgtgtacttcgtggctctggtgatcctgggagcggctgtatgtgcagca
cagccccgaggccggattctgggtggccaggaggccgcagcccatgctcggccctacatg
gcttccgtgcaagtgaacggcacacacgtgtgcggtggcaccctgctggacgagcagtgg
gtgctcagtgctgcacactgcatggatggagtgacggatgacgactctgtgcaggtgctc
ctgggtgcccactccctgtccgcccctgaaccctacaagcgatggtatgatgtgcagagt
gtagtgcctcacccgggcagccgacctgacagccttgaggacgacctcattctttttaag
ctatcccagaatgcctcgttgggtccccacgtgagacccctacccttgcaatacgaggac
aaagaagtggaacccggcacgctctgcgacgtggctggttggggtgtggtcacccatgca
ggacgcaggcctgatgtcctgcatcaactcagagtgtcaatcatgaaccggacaacctgc
aatctgcgcacgtaccatgacggggtagtcaccattaacatgatgtgtgcagagagcaac
cgcagggacacttgcaggggagactccggcagccctctagtgtgcggggatgcagtcgaa
ggtgtggttacgtggggctctcgcgtctgtggcaatggcaaaaagccgggcgtctatacc
cgagtgtcatcctaccggatgtggatcgaaaacatcacaaatggtaacatgacatcctga

DBGET integrated database retrieval system