KEGG   Mus musculus (mouse): 11539Help
Entry
11539             CDS       T01002                                 

Gene name
Adora1, A1-AR, A1AR, A1R, AA1R, AI848715, ARA1, BB176431, Ri
Definition
(RefSeq) adenosine A1 receptor
  KO
K04265  adenosine receptor A1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04923  Regulation of lipolysis in adipocytes
mmu04924  Renin secretion
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    11539 (Adora1)
   04024 cAMP signaling pathway
    11539 (Adora1)
   04022 cGMP-PKG signaling pathway
    11539 (Adora1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11539 (Adora1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    11539 (Adora1)
   04924 Renin secretion
    11539 (Adora1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    11539 (Adora1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    11539 (Adora1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    11539 (Adora1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx CcmH
Motif
Other DBs
NCBI-GeneID: 11539
NCBI-ProteinID: NP_001008533
MGI: 99401
Ensembl: ENSMUSG00000042429
Vega: OTTMUSG00000049675
UniProt: Q60612
Position
1; 1 E4
AA seq 326 aa AA seqDB search
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSEVEQAWIANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIEEDIPEEKADD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgtacatctcggccttccaggctgcctacattggcatcgaggtgctcattgcc
ttggtctctgtgcccggaaatgtactggtgatttgggctgtgaaggtgaaccaggcactt
cgcgatgctaccttctgcttcatcgtatccctggcggtagctgatgtggctgttggcgcc
ctggtcatcccactggccatccttatcaacattgggccacagacctacttccacacctgc
ctcatggtggcctgtcctgtcctcatcctcacccagagctccatcctggctctgcttgct
attgctgtggatcggtacctccgagtcaagatccctctccggtacaagacagtggtgact
cagcggcgggcagcagtggccatagccggctgctggattctctcccttgtggtaggcctg
acacccatgtttggctggaacaacctgagtgaggtggaacaagcctggatagccaacggc
agtgttggggagcccgtgatcaagtgtgagttcgagaaggttatcagcatggagtacatg
gtctacttcaacttcttcgtctgggtgctgccgccattgctcctcatggttcttatctac
ctggaggtcttctacctgatccgcaagcagctcaacaaaaaggtgtcagcctcctctggt
gacccccagaagtactacgggaaggagctcaagatcgccaagtcgctggccctcatcctc
ttcctctttgccctcagctggctaccgctacacatcttgaactgcatcaccctcttctgc
cccacctgccagaaacccagcatcctcatctacattgccatcttcctcacacacggcaac
tcggccatgaaccccatcgtctatgccttccgaatccacaagttccgggtcacctttctg
aagatttggaacgaccacttccgatgccagcccaagccccccattgaggaagatatccca
gaggagaaagctgatgactag

DBGET integrated database retrieval system