KEGG   Mus musculus (mouse): 11544Help
Entry
11544             CDS       T01002                                 

Gene name
Adprh, Arh1
Definition
(RefSeq) ADP-ribosylarginine hydrolase
  KO
K01245  ADP-ribosylarginine hydrolase [EC:3.2.2.19]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    11544 (Adprh)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.19  [protein ADP-ribosylarginine] hydrolase
     11544 (Adprh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADP_ribosyl_GH
Motif
Other DBs
NCBI-GeneID: 11544
NCBI-ProteinID: NP_031440
MGI: 1098234
Ensembl: ENSMUSG00000002844
UniProt: P54923 Q3U5N4
Position
16; 16 B4
AA seq 362 aa AA seqDB search
MGGGLIERYVAAMVLSAAGDTLGYFNGKWEFIRDGETIHQQLAQMGDLEAIDVARWRVSD
DTVMHLATAEALMEAGQSPDLPRLYSLLAKHYRDCMGDMDGRAPGGACMQNAMLLQPNRA
DGYRIPFNSHEGGCGAAMRAMCIGLRFPHPSQLDLLIQVSIESGRMTHHHPTGYLGSLAS
ALFTAYAVNGKSPWQWGKGLMEVLPEAKKYITQSGYFVKENLQHWSYFEKEWEKYLELRG
ILDGNSAPVFPQPFGVKERDQFYIDVSYSGWGGSSGHDAPMIAYDALLAAGDSWKELAHR
AFFHGGDSDSTAAIAGCWWGVMYGFKGVNPANYEKLEYRQRLEEAGRALYSLGSKEDPVL
DP
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggtggggggctgattgagaggtatgtggctgccatggtgctgagcgcggctggagat
accttgggctacttcaacgggaagtgggagttcattcgggatggggagacgatacaccag
cagttggcccagatgggtgacttggaagccatagatgtggcacgatggagagtcagtgat
gataccgtcatgcacctggccacagcggaggccctcatggaagccggccagtccccggat
ttgcctcggctgtattccctactagccaaacattaccgggactgcatgggagacatggat
ggccgggcaccaggtggtgcttgcatgcagaacgccatgctgctacagcccaacagggcc
gacggctataggattcccttcaacagtcacgagggtggctgcggggctgccatgcgcgcc
atgtgcatcgggctgaggttcccccaccccagccaactggatctgctgatccaagtgagc
atcgagagcggccggatgacccaccaccaccccacgggctacctcggcagccttgcgtcc
gctctttttacggcatatgccgtgaatggcaagtcaccatggcagtggggaaaagggcta
atggaggtgctgcctgaagccaaaaagtacatcactcagtcaggctactttgtgaaggag
aatcttcaacactggtcctacttcgagaaagaatgggaaaagtacctggagcttagagga
attttggacggcaactcggctcccgtcttcccgcagccctttggtgtgaaggaaagggat
cagttctacatcgacgtgagctactcgggctggggtggcagcagcggacacgatgccccc
atgattgcctacgatgccctcctggccgcgggggattcctggaaggagctcgcacacaga
gccttcttccacggtggagacagtgattccacggccgccattgctggctgctggtgggga
gttatgtacggctttaaaggcgtaaatcccgccaactacgagaagctcgaataccgacag
cggctagaagaggccggaagagctttgtattctctcgggtcaaaagaagaccctgtatta
gatccctag

DBGET integrated database retrieval system