KEGG   Mus musculus (mouse): 11545
Entry
11545             CDS       T01002                                 

Symbol
Parp1, 5830444G22Rik, AI893648, ARTD1, Adprp, Adprt1, C80510, PARP, PPOL, msPARP, parp-1, sPARP-1
Name
(RefSeq) poly (ADP-ribose) polymerase family, member 1
  KO
K24070  poly [ADP-ribose] polymerase 1 [EC:2.4.2.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
mmu04064  NF-kappa B signaling pathway
mmu04210  Apoptosis
mmu04217  Necroptosis
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    11545 (Parp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    11545 (Parp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    11545 (Parp1)
   04217 Necroptosis
    11545 (Parp1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    11545 (Parp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    11545 (Parp1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    11545 (Parp1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    11545 (Parp1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     11545 (Parp1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    11545 (Parp1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    11545 (Parp1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     11545 (Parp1)
SSDB
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT
Other DBs
NCBI-GeneID: 11545
NCBI-ProteinID: NP_031441
MGI: 1340806
Ensembl: ENSMUSG00000026496
Vega: OTTMUSG00000050450
UniProt: Q921K2
Position
1 H4; 1 84.44 cM
AA seq 1014 aa
MAEASERLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRQPDVEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFLAEYAKS
NRSMCKGCLEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQ
LKGFSLLSAEDKEALKKQLPAIKNEGKRKGDEVDGTDEVAKKKSKKGKDKDSSKLEKALK
AQNELIWNIKDELKKACSTNDLKELLIFNQQQVPSGESAILDRVADGMAFGALLPCKECS
GQLVFKSDAYYCTGDVTAWTKCMVKTQNPSRKEWVTPKEFREISYLKKLKVKKQDRIFPP
ESSAPAPLALPLSVTSAPTAVNSSAPADKPLSNMKILTLGKLSQNKDEAKAVIEKLGGKL
TGSANKASLCISTKKEVEKMSKKMEEVKAANVRVVCEDFLQDVSASTKSLQELLSAHSLS
SWGAEVKAEPGEVVAPKGKSAAPSKKSKGAVKEEGVNKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAVEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVKPG
TKSKLPKPVQELVGMIFDVESMKKALVEYEIDLQKMPLGKLSRRQIQAAYSILSEVQQAV
SQGSSESQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIE
REGESQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
SITLEGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
NT seq 3045 nt   +upstreamnt  +downstreamnt
atggcggaggcctcggagaggctttatcgagtggagtacgcgaagagcgggcgcgcctct
tgcaagaaatgcagcgagagtattcccaaggactccctccgcatggccatcatggtgcag
tcacccatgttcgatgggaaagtcccacactggtaccacttctcctgcttctggaaggtg
ggccactccatccggcagcctgatgttgaggtggatggcttctctgagctgcgctgggat
gatcagcagaaggtcaagaagacggccgaggctggaggcgtggcaggcaaaggccaggat
ggaagtggcggcaaggcggagaagacattgggtgactttttagcggagtacgccaagtcc
aacaggagcatgtgcaagggctgcctggagaagatagagaagggccagatgcgcctgtcc
aagaagatggtggatccagagaagccacagctgggtatgattgaccgctggtaccatcca
acttgctttgtcaagaagcgggacgagctgggcttccggcctgagtacagtgccagtcag
ctcaagggctttagcctcctctctgcagaagacaaagaagctctgaagaagcagctcccg
gccatcaagaatgaaggaaagagaaaaggtgacgaggtggatggaacagatgaagtggcc
aaaaagaaatctaagaaagggaaggacaaggatagtagtaagctggagaaggccctcaag
gctcagaatgagctgatctggaatatcaaagacgagctgaagaaagcgtgttccaccaac
gacctgaaggagctgctcatcttcaaccagcagcaggtgccgtcaggagagtcagcgatc
ttggacagagttgctgacggcatggcgtttggggcccttctgccctgcaaggagtgttca
ggccagctggtctttaagagcgacgcttattactgtactggggatgtcactgcctggacc
aagtgcatggtcaagacacagaatcctagccgaaaggaatgggtaactccaaaggaattc
cgagaaatatcctacctcaagaagttaaaggtcaaaaaacaggaccgaatattccctcca
gaaagcagcgccccagcaccactggcactgcccctctctgtcacctcagcacccacagct
gtgaactcctctgctccagcagacaagcccctgtctaacatgaagatcctgactcttggg
aagctctcccagaacaaggacgaagcaaaagctgtgattgagaaactcggaggcaagttg
acaggatctgccaacaaggcctccttgtgtatcagcactaaaaaggaggtggagaagatg
agtaagaagatggaggaagtgaaagcggccaacgttcgagttgtgtgtgaggacttcctc
caggacgtgtctgcctccactaaaagcctccaagagctgctctcggcccacagcttgtcc
tcgtggggggctgaggtgaaggcagagcctggtgaagtggtggcccccaaggggaagtca
gctgcaccctccaagaagagcaagggtgctgtcaaggaggaaggtgtcaacaaatctgaa
aagaggatgaaattaactctgaagggaggagcagccgttgatcctgactctggtctggaa
cactctgcacacgtcctggagaaaggtgggaaggtgttcagcgccacacttggcctggtg
gacattgtgaaagggacgaactcctattacaaactgcagcttctggaggacgacaaggag
agcaggtactggatcttccggtcctggggccgggtgggcacagttatcggcagtaacaaa
cttgagcagatgccctccaaagaggacgctgttgagcacttcatgaagctgtatgaagag
aagactgggaatgcctggcactcgaaaaacttcacaaagtatcccaagaagttctaccct
ctggagattgactatggccaggacgaagaggcagtaaagaagctgacggtgaagcctggc
accaagtcgaagctgccgaagccagtgcaggagctcgtggggatgatcttcgacgtggag
agcatgaaaaaggccttggtggagtacgagattgacctccagaagatgcccttggggaag
ctgagcagaaggcagatccaggccgcctactctatcctcagcgaggtccagcaggcagtg
tctcaaggcagcagtgaatcccagatcctagatctctccaatcgcttctacactctgatc
ccccatgactttggaatgaagaagcccccactcctgaacaacgcagacagcgtgcaggcc
aaggtggagatgctagacaacctcctggacatcgaggtggcctatagtcttctcaggggt
ggctctgacgacagcagcaaggatcccatcgacgtcaactacgagaaactcaaaactgac
attaaggtggttgacagagattctgaagaggccgaggtcatcaggaagtacgtgaagaac
actcatgctaccacgcacaacgcctatgacctggaagtgatcgatatcttcaagatagag
cgcgagggggagagccagcgctacaagcccttcaggcagcttcacaaccggaggctgctg
tggcacggctccaggaccaccaactttgctggcatcctgtcgcagggtctgcggatagcc
ccacctgaagcgcctgtgacaggctacatgtttgggaaagggatctactttgccgacatg
gtgtccaaaagtgcaaactactgccacacatctcagggagacccgattggcttaatactg
ctgggagaggttgcccttggaaacatgtatgaactcaagcatgcttcacatatcagcaag
ttacccaagggcaagcacagtgtcaaaggtttgggaaaaaccacccctgacccttcggcc
agcatcaccctggagggtgtagaggttccactgggaacagggatcccatctggtgtcaac
gacacctgcctgctgtataatgagtacattgtctacgacattgctcaggtgaatctcaaa
tacctgctgaaactcaagttcaattttaagacatccctgtggtaa

DBGET integrated database retrieval system