KEGG   Mus musculus (mouse): 11546Help
Entry
11546             CDS       T01002                                 

Gene name
Parp2, ADPRT-2, ARTD2, Adprt2, Adprtl2, Aspartl2, C78626, PARP-2, mPARP-2, pADPRT-2
Definition
(RefSeq) poly (ADP-ribose) polymerase family, member 2
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
mmu04210  Apoptosis
mmu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    11546 (Parp2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    11546 (Parp2)
   04217 Necroptosis
    11546 (Parp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    11546 (Parp2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    11546 (Parp2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    11546 (Parp2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     11546 (Parp2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     11546 (Parp2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    11546 (Parp2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     11546 (Parp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR
Motif
Other DBs
NCBI-GeneID: 11546
NCBI-ProteinID: NP_033762
MGI: 1341112
Ensembl: ENSMUSG00000036023
UniProt: O88554
Structure
PDB: 

Position
14 26.25 cM; 14 C1
AA seq 559 aa AA seqDB search
MAPRRQRSGSGRRVLNEAKKVDNGNKATEDDSPPGKKMRTCQRKGPMAGGKDADRTKDNR
DSVKTLLLKGKAPVDPECAAKLGKAHVYCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDD
AQRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKKFLDKTKNNWEDRENFEKVPGK
YDMLQMDYAASTQDESKTKEEETLKPESQLDLRVQELLKLICNVQTMEEMMIEMKYDTKR
APLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALVEACNEFYTRIPHDFGLSIPPVIRTE
KELSDKVKLLEALGDIEIALKLVKSERQGLEHPLDQHYRNLHCALRPLDHESNEFKVISQ
YLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAFREDLPNRMLLWHGSRLSNWVGILSHGLR
VAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPK
AQGLLRGKHSTKGMGKMAPSPAHFITLNGSTVPLGPASDTGILNPEGYTLNYNEFIVYSP
NQVRMRYLLKIQFNFLQLW
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcggcggcagagatcaggctctggaaggcgagtgctaaatgaagccaagaaa
gttgataatggcaacaaagcaacagaagacgactctcctcctggcaagaagatgcgcacg
tgccagagaaaagggcctatggctggagggaaggacgcagacaggacaaaagacaatcga
gactctgtgaagaccttgctgttaaagggcaaagcccctgtggacccagagtgtgcagcc
aagctgggaaaggctcatgtgtattgtgaaggagatgatgtctatgatgtcatgctaaat
caaaccaatctccagttcaacaacaacaagtactaccttattcagctgttagaagatgat
gcccagaggaacttcagtgtttggatgaggtggggccgagttggaaagacggggcagcac
agcttggtgacttgttctggtgacctcaacaaagcaaaagaaatatttcagaaaaaattc
cttgacaaaactaaaaacaattgggaggaccgtgagaactttgaaaaagtacctggaaaa
tacgacatgttacagatggactatgctgccagcacgcaggatgaaagtaaaacaaaagaa
gaggaaactttgaagcctgagtctcagctggatcttcgagtccaggagctgctaaagttg
atctgtaacgtgcagaccatggaagaaatgatgattgagatgaagtatgacaccaagaga
gccccgcttggaaagctgacagtggcgcaaatcaaggccggttaccagtctctcaagaag
attgaggactgcatccgcgctggccagcatgggcgagcgcttgttgaagcgtgcaatgaa
ttctacaccaggatccctcatgactttggactctccatccctccagtaatccggacagag
aaggaactgtcagacaaagtaaaactgctagaggcattgggagacattgaaattgccctt
aaactggtgaagtcagagcgccaaggcctagaacacccactggaccaacactatagaaac
ctacactgtgctttgcgtcctctggaccatgaaagtaatgagtttaaggtgatttctcag
tacctacagtctacgcatgctcctacacacaaggactatactatgaccttgctggatgtt
ttcgaagtagagaaggaaggggagaaagaggccttcagggaggaccttcctaacaggatg
ctgctctggcatggatccaggctgagtaactgggtggggatcctgagccacgggcttaga
gttgccccacctgaggctcccatcacaggttatatgtttggaaaaggaatctactttgct
gacatgtcctccaagagtgccaattactgctttgcctctcgcctaaagaatacaggattg
cttcttctgtcagaggtagctctaggtcagtgtaatgaactactggaggccaatcctaaa
gcacaaggattgcttcggggcaagcatagcaccaaggggatgggaaagatggctcccagc
cctgcccacttcatcaccctgaatgggagtacagtgcccttaggaccagcaagtgacaca
ggaattctcaatccagaggggtacaccctcaactacaatgagtttattgtttatagcccc
aaccaggtccgtatgcgataccttctaaagattcaatttaacttcctgcagctatggtga

DBGET integrated database retrieval system