KEGG   Mus musculus (mouse): 11550Help
Entry
11550             CDS       T01002                                 

Gene name
Adra1d, Adra-1, Adra1, Adra1a, Gpcr8, Spr8, [a]1d, alpha1D-AR
Definition
(RefSeq) adrenergic receptor, alpha 1d
  KO
K04137  adrenergic receptor alpha-1D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    11550 (Adra1d)
   04022 cGMP-PKG signaling pathway
    11550 (Adra1d)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11550 (Adra1d)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11550 (Adra1d)
   04270 Vascular smooth muscle contraction
    11550 (Adra1d)
  09154 Digestive system
   04970 Salivary secretion
    11550 (Adra1d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    11550 (Adra1d)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    11550 (Adra1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 11550
NCBI-ProteinID: NP_038488
MGI: 106673
Ensembl: ENSMUSG00000027335
Vega: OTTMUSG00000016190
UniProt: A2ANQ2
Position
2 F1; 2 63.5 cM
AA seq 562 aa AA seqDB search
MTFRDILSVTFEGPRASSSTGGSGAGGGAGTVGPEGPAVGGVPGATGGSAVVGTGSGEDN
QSSTAEAGAAASGEVNGSAAVGGLVVSAQGVGVGVFLAAFILTAVAGNLLVILSVACNRH
LQTVTNYFIVNLAVADLLLSAAVLPFSATMEVLGFWAFGRTFCDVWAAVDVLCCTASILS
LCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWAVALVVSVGPLLGWKEPVPPDERFC
GITEEVGYAIFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGIKREPGKASEVVLRI
HCRGAATSAKGNPGTQSSKGHTLRSSLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFF
VLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQCRRRRR
RLWRVYGHHWRASTGDPRSDCAPSPRIAPPGAPLALTAHPGPGSVDTPEAQASVSGRRKP
ASALREWRLLGPLQRPTTQLRAKVSSLSHKFRSGGARRAETACALRSEVEAVSLNVPQDG
AEAVICQAYEPGDLSNLRETDI
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgactttccgcgacatcctgagcgtcactttcgaaggaccccgggcgagcagtagcact
gggggctccggcgcgggcggcggagctggcacggttggccccgagggtccggcggtgggc
ggcgtgccgggtgccacaggcggtagcgctgtggtgggaaccggcagcggcgaggacaac
cagagctccacggcagaagcgggggccgcggcaagcggcgaggtgaatggctcggcggcc
gtcggggggctagtggtgagtgctcagggcgtgggagtgggtgtcttcctagccgccttc
atcctcaccgctgtggcgggcaaccttctcgtcatcctctccgtggcctgcaaccgccac
ttgcagacggtcaccaactatttcatcgtgaacctagcagtggctgacctgctactgagt
gcagctgtgttgcccttctcagccactatggaggttctaggcttctgggccttcggccgg
accttctgcgacgtatgggccgcggtggacgtgctatgctgcactgcctccatccttagc
ctctgcaccatctctgtggaccggtacgtgggtgtgcgccactcgctcaagtatccagcc
attatgacagaacgcaaggccgctgccattctggctctgctctgggcggtggccttggtg
gtatctgtgggaccgctactaggttggaaggaaccagtgcccccggatgagcgtttctgc
ggcatcaccgaggaggtgggctatgcgatcttctcttccgtatgctccttctacctcccc
atggcagtgatcgtggtcatgtactgccgcgtgtatgtggtcgcgcgcagcaccacgcgc
agcctcgaggcgggcatcaagagggagccgggcaaggcctctgaggtggttctgaggatc
cactgtcgcggcgcagccactagcgccaaaggaaatccagggacacagagtagcaagggg
cacaccttgcgcagctcgctctccgtaaggctgctcaagttttcccgcgagaaaaaggct
gccaagaccctagccatcgtcgtgggtgtcttcgtcctgtgctggttcccctttttcttc
gtcctgcctctgggttctctgttccctcagctgaaaccatcagagggcgtcttcaaggtc
atcttctggctgggctacttcaatagctgtgtgaacccgctcatctacccctgctccagt
cgcgagttcaagcgcgccttcctccgcctcctgcgctgccagtgtcgccgccgccgccgc
cgcctctggcgagtctacggccaccactggcgagcctcgaccggcgacccgcgctccgac
tgtgcccccagcccgcgcatcgcaccccccggggctcccctagccctcactgcacaccca
ggcccgggctccgtagacacgccggaggcgcaggcttcggtctccggccgtcgaaagcca
gcctccgccctccgggagtggaggctgcttgggccgctacagagacccacgacccagctg
cgtgcgaaggtgtccagcctgtcccataagttccgctctgggggcgcgcggcgcgcggag
actgcgtgtgccctgcgctcggaggtagaagcagtgtccctaaatgttccccaagacggg
gcagaggctgtcatctgccaggcttatgagccgggcgacctcagcaacctccgggagact
gacatttaa

DBGET integrated database retrieval system