KEGG   Mus musculus (mouse): 11552
Entry
11552             CDS       T01002                                 

Gene name
Adra2b, Adra-2b, [a]2B, a2b-AR, alpha2-C2, alpha2B
Definition
(RefSeq) adrenergic receptor, alpha 2b
  KO
K04139  adrenergic receptor alpha-2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    11552 (Adra2b)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11552 (Adra2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    11552 (Adra2b)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    11552 (Adra2b)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 11552
NCBI-ProteinID: NP_033763
MGI: 87935
Ensembl: ENSMUSG00000058620
Vega: OTTMUSG00000016023
UniProt: Q925K6 F8VQ23
Position
2 F1; 2 61.95 cM
AA seq 448 aa
MVHQEPYSVQATAAIASAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFWRAWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQRPEPHGLPQCELNQEAWYILASSIGS
FFAPCLIMILVYLRIYVIAKRSHCRGLGAKRGSGEGESKKPHPAAGGVPASAKVPTLVSP
LSSVGEANGHPKPPREKEEGETPEDPEARALPPNWSALPRSVQDQKKGTSGATAEKGAEE
DEEEVEECEPQTLPASPASVFNPPLQQPQTSRVLATLRGQVLLSKNVGVASGQWWRRRTQ
LSREKRFTFVLAVVIGVFVVCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSSLN
PVIYTIFNQDFRRAFRRILCRQWTQTGW
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggtccaccaggagccctactcggtgcaggccaccgccgccatcgcgtcggccatcacc
tttctcatcctcttcaccattttcggcaatgcgctggtaattctggctgtgttgaccagc
cgctctctccgtgcaccacaaaacctcttcctggtgtcactggcagcagccgacatccta
gtggctactcttatcatccctttctctctggccaacgagctgctgggctattggtacttc
tggcgtgcgtggtgcgaggtctacctggcgctagacgtgctcttctgtacctcctccatc
gtgcacctgtgtgccatcagtctggacagatactgggcagtgagccgagcattggagtac
aactccaagcgcactccacgccgcatcaaatgcatcatcctcaccgtgtggctcattgca
gccgtcatttctctaccgcccctcatctacaagggcgaccagcgcccagagccccacggg
ctcccccagtgtgagctcaaccaagaagcctggtacatcttggcttccagcatcggatct
ttttttgctccctgcctcatcatgattctcgtctacctgcgaatctatgtaattgccaaa
cgcagccactgcagaggtctcggagctaagaggggctctggggagggtgagtccaagaag
ccccatccggccgccgggggagttccagcctcggctaaagtgcccaccctggtctctcct
ctatcttctgtcggagaggctaatggacaccccaagcctccaagggagaaggaggagggg
gagacccctgaagatcccgaagccagggctttgccacccaattggtctgccctgcccaga
tcagtccaggaccagaagaaggggactagtggggcaactgcagagaagggagctgaagag
gatgaagaggaggtggaagaatgtgaaccccaaacactgccagcttctcctgcctcagta
ttcaacccacccttgcagcagcctcagacttcccgggtgctggccacgctacgtggccag
gtgcttctgagcaagaatgtgggtgtggccagtgggcagtggtggcgccgtcggacacag
ctgagccgagagaagaggttcacctttgtgctggcggtggtcattggtgtttttgtggtc
tgttggtttcctttcttcttcagctacagcctgggggccatctgcccacagcactgcaag
gtaccccatggcctcttccagttcttcttctggattggctactgcaacagctctttgaat
cctgtcatctacaccatcttcaaccaggacttccgccgtgcctttcgaaggatcctttgc
cggcagtggacccagactggctggtga

DBGET integrated database retrieval system