KEGG   Mus musculus (mouse): 11554Help
Entry
11554             CDS       T01002                                 

Gene name
Adrb1, Adrb-1, beta-AR
Definition
(RefSeq) adrenergic receptor, beta 1
  KO
K04141  adrenergic receptor beta-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04540  Gap junction
mmu04923  Regulation of lipolysis in adipocytes
mmu04924  Renin secretion
mmu04970  Salivary secretion
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    11554 (Adrb1)
   04024 cAMP signaling pathway
    11554 (Adrb1)
   04022 cGMP-PKG signaling pathway
    11554 (Adrb1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11554 (Adrb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    11554 (Adrb1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    11554 (Adrb1)
   04924 Renin secretion
    11554 (Adrb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11554 (Adrb1)
  09154 Digestive system
   04970 Salivary secretion
    11554 (Adrb1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    11554 (Adrb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    11554 (Adrb1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    11554 (Adrb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 11554
NCBI-ProteinID: NP_031445
MGI: 87937
Ensembl: ENSMUSG00000035283
UniProt: P34971
Position
19 D2; 19 51.96 cM
AA seq 466 aa AA seqDB search
MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLASPPASLLPPASEGSAPLSQQWTAG
MGLLLALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARALVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPEPSPSPGPPRPADSLANGRSSKRRP
SRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSA
FNPIIYCRSPDFRKAFQRLLCCARRAACRRRAAHGDRPRASGCLARAGPPPSPGAPSDDD
DDDAGTTPPARLLEPWTGCNGGTTTVDSDSSLDEPGRQGFSSESKV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgggggcgctcgccctgggcgcctccgaaccctgcaacctgtcgtccgccgcg
ccgctgcccgacggtgcggccaccgcggcgcggctgctggtgctcgcgtcgcctcccgcc
tcgctgctgcctccagccagcgagggctcagcgccgctgtcgcagcagtggaccgcgggt
atgggcctactgctggcgctcatcgttctgctcatcgtggtgggtaacgtgctggtgatc
gtggccatcgccaagaccccgcggctgcagacgctcaccaacctcttcatcatgtccctg
gccagcgctgatctggtcatgggattgctggtggtgcctttcggggccaccatcgtggtg
tggggccgctgggagtacggctccttcttctgcgagctctggacttcggtagatgtgctg
tgtgtgacggccagcattgagaccctgtgtgtcatcgccctggaccgctacctcgccatc
acgtcgccctttcgctaccagagtttgctgacgcgcgcgcgagcgcgggccctcgtgtgc
acagtgtgggccatctcggcgttggtgtccttcctgcccatcctcatgcactggtggcgg
gccgagagcgacgaagcgcgccgctgctacaacgaccccaagtgctgcgatttcgtcacc
aacagggcctacgccatcgcctcgtccgtcgtctccttctacgtgcccctgtgcatcatg
gccttcgtgtacctgcgggtgttccgcgaggcccaaaaacaggtaaagaagatcgacagc
tgcgagcgccgcttcctcggcggcccagcccggccgccctcgcctgagccctcgccgtca
cctgggccaccgcgccccgcagactcgctggccaacgggcgctccagcaagcggcggccg
tcgcgcctcgtggctctgcgcgagcagaaggcgctcaagacactgggcatcatcatgggt
gtgttcacgctctgctggctgcccttcttcctggccaacgtggtgaaggctttccaccgc
gacctggtgccggatcgcctcttcgtcttcttcaactggctgggctacgccaactcggcc
ttcaaccccatcatctactgccgcagccccgacttccgcaaggctttccagcgcctgctc
tgctgcgcgcgccgggccgcctgcagacgccgcgcagcccacggggaccggccgcgcgcc
tccggctgcctggcgagagctgggccgccgccgtcccccggagctccctcggacgacgac
gacgacgacgccgggaccaccccaccggcgcgcctgctggagccctggaccggctgcaac
ggcgggacaaccactgtggacagcgattcgagcctggacgagccggggcgccagggcttc
tcctcggagtccaaggtgtag

DBGET integrated database retrieval system