KEGG   Mus musculus (mouse): 11555Help
Entry
11555             CDS       T01002                                 

Gene name
Adrb2, Adrb-2, Badm, Gpcr7
Definition
(RefSeq) adrenergic receptor, beta 2
  KO
K04142  adrenergic receptor beta-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04923  Regulation of lipolysis in adipocytes
mmu04924  Renin secretion
mmu04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    11555 (Adrb2)
   04024 cAMP signaling pathway
    11555 (Adrb2)
   04022 cGMP-PKG signaling pathway
    11555 (Adrb2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11555 (Adrb2)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    11555 (Adrb2)
   04924 Renin secretion
    11555 (Adrb2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11555 (Adrb2)
  09154 Digestive system
   04970 Salivary secretion
    11555 (Adrb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    11555 (Adrb2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    11555 (Adrb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 11555
NCBI-ProteinID: NP_031446
MGI: 87938
Ensembl: ENSMUSG00000045730
UniProt: P18762
Position
18 E1; 18 35.1 cM
AA seq 418 aa AA seqDB search
MGPHGNDSDFLLAPNGSRAPDHDVTQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAK
FERLQTVTNYFIISLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKK
AIDCYTEETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF
HAQNLSQVEQDGRSGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRD
NLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSSKTYGNGYSSNSNG
RTDYTGEPNTCQLGQEREQELLCEDPPGMEGFVNCQGTVPSLSVDSQGRNCSTNDSPL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggggccacacgggaacgacagcgacttcttgctggcacccaacggaagccgagcgcca
gaccacgacgtcactcaggaacgggacgaagcgtgggttgtgggcatggccatcctcatg
tcggttatcgtcctggccatcgtgtttggcaacgtgctggtcatcacagccattgccaag
ttcgagcgactacaaaccgtcaccaactacttcataatctccttggcgtgtgctgatcta
gtcatgggcctagcggtggtgccgtttggggccagtcacatccttatgaaaatgtggaat
tttggcaacttctggtgcgagttctggacttccattgatgtgttgtgcgtcacagccagc
atcgagaccctgtgcgtgattgcagtggatcgctatgttgctatcacatcgcccttcaag
taccagagcctgctgaccaagaataaggcccgagtggtcatcctgatggtatggattgta
tctggccttacctcctttttgcctatccagatgcactggtaccgtgccacccacaagaaa
gctatcgattgttacaccgaggagacttgctgtgacttcttcacgaaccaggcctacgcc
atcgcgtcctcgattgtgtctttctacgtgcccctggtggtgatggtctttgtctattcc
cgggtcttccaggtggccaaaaggcagctgcagaagatagacaaatctgaaggaagattc
cacgcccaaaacctcagccaggtggagcaggatgggcggagcggccacggactccgaagg
tcctccaagttctgcttgaaagagcacaaagccctcaagactttaggcatcatcatgggc
acattcaccctctgctggctgcccttcttcattgtcaatatcgtgcacgttatcagggac
aacctcatccctaaggaagtttacatcctccttaactggttgggctacgtcaactctgcc
ttcaatcctcttatctactgtcggagtccagatttcaggattgcctttcaagagcttctg
tgccttcgcaggtcttcttcgaaaacctatgggaacggctactctagcaatagcaacggc
agaacggactacacaggggagccaaacacttgtcagctggggcaggagagagaacaggaa
ctgctgtgtgaggatcccccaggcatggaaggctttgtgaactgtcaaggtactgtgcct
agccttagcgttgactcccaaggaaggaactgtagtacaaatgactcgccactgtaa

DBGET integrated database retrieval system