KEGG   Mus musculus (mouse): 11564Help
Entry
11564             CDS       T01002                                 

Gene name
Adsl, Adl, Asl
Definition
(RefSeq) adenylosuccinate lyase
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu00250  Alanine, aspartate and glutamate metabolism
mmu01100  Metabolic pathways
Module
mmu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
mmu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    11564 (Adsl)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    11564 (Adsl)
Enzymes [BR:mmu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     11564 (Adsl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lyase_1 ADSL_C DUF4089 HTH_Tnp_Tc5 Wtap DUF1331
Motif
Other DBs
NCBI-GeneID: 11564
NCBI-ProteinID: NP_033764
MGI: 103202
Ensembl: ENSMUSG00000022407
Vega: OTTMUSG00000035645
UniProt: P54822
Position
15 E1; 15 37.95 cM
AA seq 484 aa AA seqDB search
MAASGDPGSAESYRSPLAARYASREMCFLFSDRYKFQTWRQLWLWLAEAEQTLGLPITDE
QIQEMKSNLNNIDFQMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTD
LIILRNAFDLLLPKLARVISRLADFAKDRADLPTLGFTHFQPAQLTTVGKRCCLWIQDLC
MDLQNLKRVRDELRFRGVKGTTGTQASFLQLFEGDHQKVEQLDKMVTEKAGFKRAFIITG
QTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMR
SERCCSLARHLMALTMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISE
GLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAAAVVKQEGGD
NDLIERIRADAYFSPIHSQLEHLLDPSSFTGRAPQQVHRFLEEEVRPLLKPYGNEMAVKA
ELCL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatccggcgaccctggcagtgctgaaagttaccgttctccgctggcggcccgc
tacgccagccgcgagatgtgtttcttgttcagcgacaggtacaagttccagacgtggcgg
cagctgtggctgtggctggcggaggccgaacagacgctgggtttgcctatcacagatgaa
caaatccaggagatgaagtcgaacctgaacaacattgacttccagatggcagctgaggaa
gagaagcgcctgcggcacgacgtgatggctcacgtgcacacgtttggccactgctgtccg
aaagctgcgggcattattcatctgggcgccacctcctgctatgtcggagacaatacggac
ctgattattctgagaaatgcatttgacctacttttgccaaagcttgctagagtgatctcg
aggcttgccgactttgctaaggatcgtgctgatctgcccacgttaggtttcacacacttt
cagcctgctcagctgaccacggttgggaaacgatgctgcctttggattcaagatctctgc
atggatctccagaacttgaagcgtgtccgggatgagctgcgcttccgaggagtaaagggc
accactggcacgcaggccagcttcctgcagctcttcgagggggatcaccagaaggtggag
cagctggacaagatggtgacagaaaaggcagggtttaaaagagccttcatcatcacagga
cagacgtacacacggaaagtggacatcgaagtgctgtctgtgctggccagcttaggagca
tcggtgcacaagatttgcactgacatacgcctgctggcaaacctgaaggagatggaggag
ccctttgagaaacagcagattggctccagtgcgatgccgtacaagcggaaccccatgcgc
tccgaacgttgctgcagcctggcccgtcacctgatggcccttaccatggacccactacag
acagcgtctgtgcagtggtttgaacgtactctggatgacagtgccaaccgacggatctgt
ttggctgaagcgtttctcactgcagatactatattaaacaccctacagaacatttctgaa
ggattggtggtgtaccccaaagtaattgaacggcgcattcggcaagagctgcctttcatg
gccacagagaacatcatcatggcaatggtgaaagccgggggcagccgacaggactgccat
gagaaaattagagtgctttcccagcaggcagctgctgtggtcaagcaggaaggaggtgac
aatgaccttatagagcgcatccgggcagatgcctacttcagccccatccactcacagctg
gagcacttgctggacccctcttctttcactggccgagcaccccagcaggtccacagattc
ctggaagaggaagtgcgccccctgctaaagccctatgggaatgagatggcggtgaaagca
gagctgtgtctgtag

DBGET integrated database retrieval system