KEGG   Mus musculus (house mouse): 11565
Entry
11565             CDS       T01002                                 
Symbol
Adss1, Adss, Adssl1
Name
(RefSeq) adenylosuccinate synthase 1
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00230  Purine metabolism
mmu00250  Alanine, aspartate and glutamate metabolism
mmu01100  Metabolic pathways
mmu01232  Nucleotide metabolism
mmu01240  Biosynthesis of cofactors
Module
mmu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    11565 (Adss1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    11565 (Adss1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     11565 (Adss1)
SSDB
Motif
Pfam: Adenylsucc_synt MBF1
Other DBs
NCBI-GeneID: 11565
NCBI-ProteinID: NP_031447
MGI: 87947
Ensembl: ENSMUSG00000011148
Position
12:112586481..112607789
AA seq 457 aa
MSGTRASNDRPPGTGGVKRGRLQQEAAATGSRVTVVLGAQWGDEGKGKVVDLLATDADIV
SRCQGGNNAGHTVVVDGKEYDFHLLPSGIINTKAVSFIGNGVVIHLPGLFEEAEKNEKKG
LKDWEKRLIISDRAHLVFDFHQAVDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGL
RICDLLSDFDEFSARFKNLAHQHQSMFPTLEIDVEGQLKRLKGFAERIRPMVRDGVYFMY
EALHGPPKKVLVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGIPPQNIGDVYGVVKA
YTTRVGIGAFPTEQINEIGDLLQNRGHEWGVTTGRKRRCGWLDLMILRYAHMVNGFTALA
LTKLDILDVLSEIKVGISYKLNGKRIPYFPANQEILQKVEVEYETLPGWKADTTGARKWE
DLPPQAQSYVRFVENHMGVAVKWVGVGKSRESMIQLF
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgtccgggacccgagcctccaacgaccggccccccggcacaggcggagtcaagaggggg
cggctgcagcaggaggcggcggcgacaggctcccgcgtgaccgtggtgctgggcgcgcag
tggggggacgagggcaaaggcaaggtggtggacctgctggccacggacgccgacatcgtc
agtcgctgccaggggggcaacaatgcggggcacacagtagtggtggacggcaaggagtat
gactttcacctgctccccagcggcatcatcaacaccaaggccgtgtcattcattggcaat
ggcgtggtcatccacttgccgggcttgtttgaagaggcagagaagaacgagaagaaaggg
ctgaaggactgggagaagcgtctcatcatctctgaccgggctcaccttgtgttcgacttc
caccaggcagtggacgggctgcaggaagtacaacgtcaagcacaagaggggaagaatatc
ggcaccaccaagaagggaatcggaccaacttactcctccaaagctgcccggacaggcctc
cgcatctgtgaccttctctcggattttgacgagttttctgccagattcaagaacctggcc
caccagcaccagtccatgttccccaccctggaaatagatgtggaaggtcaactcaaaagg
ctcaagggctttgctgagcgcatcagacccatggttcgagatggtgtctacttcatgtat
gaagccctgcatggtccccccaaaaaggtcctggtggaaggtgccaacgcggccctgctc
gacatcgatttcgggacctacccctttgtgacttcttccaactgcactgtgggtggtgtg
tgcaccggcctgggcatcccgccccagaacataggcgatgtgtatggtgtggtaaaggcc
tacaccacccgtgtgggcattggggccttccccacggagcagatcaatgaaattggagat
ctgctgcagaaccgtggccatgagtggggggtgaccacaggcaggaagaggcgctgcggc
tggctggacctgatgatcctccgatacgctcacatggtcaatggcttcactgcgctggca
ttgaccaagctggacatactggatgtcctgagcgagattaaagttggcatctcctacaag
ctcaacggaaagaggattccctacttccctgctaaccaggagatcctgcagaaggtggag
gtcgagtatgaaacactgcctggatggaaagcagacaccacaggcgccaggaagtgggag
gacctgcctccgcaggcccaaagctacgtgcgcttcgtggagaatcacatgggtgttgca
gtcaaatgggtcggcgttgggaagtccagagagtccatgatccagcttttttag

DBGET integrated database retrieval system