KEGG   Mus musculus (mouse): 11568
Entry
11568             CDS       T01002                                 

Gene name
Aebp1, A, ACLP
Definition
(RefSeq) AE binding protein 1
  KO
K21392  adipocyte enhancer-binding protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    11568 (Aebp1)
Motif
Pfam: Peptidase_M14 F5_F8_type_C CarboxypepD_reg CarbopepD_reg_2
Other DBs
NCBI-GeneID: 11568
NCBI-ProteinID: NP_033766
MGI: 1197012
Ensembl: ENSMUSG00000020473
Vega: OTTMUSG00000005099
UniProt: Q640N1
Position
11; 11 A1
AA seq 1128 aa
MAPVRTASLLCGLLALLTLCPEGNPQTVLTDDEIEEFLEGFLSELETQSPPREDDVEVQP
LPEPTQRPRKSKAGGKQRADVEVPPEKNKDKEKKGKKDKGPKATKPLEGSTRPTKKPKEK
PPKATKKPKEKPPKATKKPKEKPPKATKKPKEKPPKATKRPSAGKKFSTVAPLETLDRLL
PSPSNPSAQELPQKRDTPFPNAWQGQGEETQVEAKQPRPEPEEETEMPTLDYNDQIEKED
YEDFEYIRRQKQPRPTPSRRRLWPERPEEKTEEPEERKEVEPPLKPLLPPDYGDSYVIPN
YDDLDYYFPHPPPQKPDVGQEVDEEKEEMKKPKKEGSSPKEDTEDKWTVEKNKDHKGPRK
GEELEEEWAPVEKIKCPPIGMESHRIEDNQIRASSMLRHGLGAQRGRLNMQAGANEDDYY
DGAWCAEDESQTQWIEVDTRRTTRFTGVITQGRDSSIHDDFVTTFFVGFSNDSQTWVMYT
NGYEEMTFYGNVDKDTPVLSELPEPVVARFIRIYPLTWNGSLCMRLEVLGCPVTPVYSYY
AQNEVVTTDSLDFRHHSYKDMRQLMKAVNEECPTITRTYSLGKSSRGLKIYAMEISDNPG
DHELGEPEFRYTAGIHGNEVLGRELLLLLMQYLCQEYRDGNPRVRNLVQDTRIHLVPSLN
PDGYEVAAQMGSEFGNWALGLWTEEGFDIFEDFPDLNSVLWAAEEKKWVPYRVPNNNLPI
PERYLSPDATVSTEVRAIISWMEKNPFVLGANLNGGERLVSYPYDMARTPSQEQLLAEAL
AAARGEDDDGVSEAQETPDHAIFRWLAISFASAHLTMTEPYRGGCQAQDYTSGMGIVNGA
KWNPRSGTFNDFSYLHTNCLELSVYLGCDKFPHESELPREWENNKEALLTFMEQVHRGIK
GVVTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGYTSSAKICNV
DYDIGATQCNFILARSNWKRIREILAMNGNRPILRVDPSRPMTPQQRRMQQRRLQYRLRM
REQMRLRRLNSTAGPATSPTPALMPPPSPTPAITLRPWEVLPTTTAGWEESETETYTEVV
TEFETEYGTDLEVEEIEEEEEEEEEEMDTGLTFPLTTVETYTVNFGDF
NT seq 3387 nt   +upstreamnt  +downstreamnt
atggctccagtgcgcaccgcatccctgctctgcggcctcctggcactgctgacgctgtgc
cctgaggggaacccacagacggtgctgacggacgacgagatcgaggagttcctcgaaggc
ttcctttcggagttggagacccagtccccgccccgggaagacgacgtggaagtccagccg
cttcccgaacccacccagcgtccccgcaaatccaaggcagggggcaagcagcgggcagat
gtagaagtccctccagaaaaaaacaaagacaaagagaagaaaggaaagaaggacaaaggc
cccaaagccacaaaacccctggagggctctaccaggcccaccaagaaaccaaaggagaag
ccacccaaggccaccaagaagcccaaggagaaaccacccaaggccaccaagaagcccaag
gagaagccacccaaggccaccaagaagcctaaggagaagccacccaaggccactaagagg
ccctcggcaggaaagaagttctcaactgtggcccccttggaaacgctggatcggttactc
ccctcaccctccaaccccagcgcccaggagctaccgcagaagagagacacacccttccca
aatgcctggcaaggtcaaggagaagagacccaggtggaggccaagcagccccggccagag
ccagaggaggagactgagatgcccacactggactacaatgaccagatagagaaggaggat
tacgaggattttgagtacatccgtcgccagaagcagcccaggccaacacccagcaggagg
aggctctggccagagcgccctgaggagaagactgaagagccagaggaaaggaaggaagtc
gagccacctctgaagcccctgctgcctccggactatggggatagctacgtgatccccaac
tatgatgacttggactattatttcccccaccctccaccgcagaagcctgatgttggacaa
gaggtggatgaggaaaaggaagagatgaagaagcccaaaaaggagggtagtagccccaag
gaggacacagaggacaagtggaccgtggagaaaaacaaggaccacaaagggccccggaag
ggtgaggagctggaggaggagtgggcgccagtggagaaaatcaagtgcccacctattggg
atggagtcacaccgcattgaggacaaccagatccgtgcctcctccatgctgcgccacggc
ctcggagcccagcggggccggctcaacatgcaggctggtgccaatgaagatgactactat
gacggggcatggtgtgctgaggacgagtcgcagacccagtggatcgaggtggacacccga
aggacaactcggttcacgggcgtcatcactcagggccgtgactccagcatccatgacgac
ttcgtgactaccttctttgtgggcttcagcaatgacagccagacctgggtgatgtacacc
aatggctacgaggaaatgaccttctatggaaatgtggacaaggacacacctgtgctgagc
gagctccctgagccagttgtggcccgtttcatccgcatctatccactcacctggaacggt
agcctgtgcatgcgcctggaggtgctaggctgccccgtgacccctgtctacagctactac
gcacagaatgaggtggtaactactgacagcctggacttccggcaccacagctacaaggac
atgcgccagctgatgaaggctgtcaatgaggagtgccccacaatcactcgcacatacagc
ctgggcaagagttcacgagggctcaagatctacgcaatggaaatctcagacaaccctggg
gatcatgaactgggggagcccgagttccgctacacagccgggatccacggcaatgaggtg
ctaggccgagagctcctgctcctgctcatgcaatacctatgccaggagtaccgcgatggg
aacccgagagtgcgcaacctggtgcaggacacacgcatccacctggtgccctcgctgaac
cctgatggctatgaggtggcagcgcagatgggctcagagtttgggaactgggcactgggg
ctgtggactgaggagggctttgacatcttcgaggacttcccagatctcaactctgtgctc
tgggcagctgaggagaagaaatgggtcccctacagggtcccaaacaataacttgccaatc
cctgaacgttacctgtccccagatgccacggtctccacagaagtccgggccattatttcc
tggatggagaagaacccctttgtgctgggtgcaaatctgaacggtggtgagcggcttgtg
tcttatccctatgacatggcccggacacctagccaggagcagctgttggccgaggcactg
gcagctgcccgcggagaagatgatgacggggtgtctgaggcccaggagactccagatcac
gctattttccgctggctggccatctcatttgcctccgcccatctcaccatgacggagccc
taccggggagggtgccaggcccaggactacaccagcggcatgggcattgtcaacggggcc
aagtggaatcctcgctctgggactttcaatgactttagctacctgcacacaaactgtctg
gagctctccgtatacctgggctgtgacaagttcccccacgagagtgagctaccccgagaa
tgggagaacaacaaagaagcgctgctcaccttcatggagcaggtgcaccgtggcattaag
ggtgtggtgacagatgagcaaggcatccccattgccaatgccaccatctctgtgagtggc
atcaaccatggtgtgaagacagcaagtggaggtgactactggcgcattctgaacccgggt
gagtaccgtgtgacagctcacgcagagggctacacctcaagtgccaagatctgcaatgtg
gactacgatattggggccactcagtgcaacttcatcctggctcgatccaactggaagcgc
attcgggagatcttggctatgaacgggaaccgtcccattctccgagttgacccctcacga
cccatgaccccccagcagcggcgcatgcagcagcgccgtctacagtaccggctccgcatg
agggaacagatgcgactgcgtcgcctcaattctaccgcaggccctgccacaagccccact
cctgcccttatgcctcccccttcccctacaccagccattaccttgaggccctgggaagtt
ctacccactaccactgcaggctgggaggagtcagagactgagacctatacagaagtagtg
acagagtttgagacagagtatgggactgacctagaggtggaagagatagaggaggaggag
gaggaggaggaggaagagatggacacaggccttacatttccactcacaacagtggagacc
tacacagtgaactttggggacttctga

DBGET integrated database retrieval system