KEGG   Mus musculus (mouse): 11572Help
Entry
11572             CDS       T01002                                 

Gene name
Crisp3, Aeg2, CRISP-3, CRS3, SGP28
Definition
(RefSeq) cysteine-rich secretory protein 3
  KO
K19919  cysteine-rich secretory protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11572 (Crisp3)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    11572 (Crisp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAP Crisp
Motif
Other DBs
NCBI-GeneID: 11572
NCBI-ProteinID: NP_033769
MGI: 102552
Ensembl: ENSMUSG00000025433
Vega: OTTMUSG00000028254
UniProt: Q03402
Position
17 B2; 17 19.45 cM
AA seq 241 aa AA seqDB search
MALMLVLFFLAAVLPPSLLQDNSQENSLEKLSTSKKSVQEEIVSKHNQLRRKVSPSGSDL
LNMEWNYDAQVNAQQRADKCTFSHSPIELRTTNLKCGENLFMSSYLVPWSSVIQGWYNES
KGLIFGVGPKQNVSVVGHHTQVVWKSNLQVACGVAECPENPLRYFYVCRYCPVLNYSGHY
PSRPYLAYTARAPCASCPDRCEDGLCTKSCQYKDMSFWCKRLEYVCKHPGLKKRCLATCQ
C
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcattaatgcttgtgctgttcttcctggctgctgtactgcccccatcccttcttcaa
gataactctcaggagaacagtcttgagaaactttcaaccagtaaaaaatcagtccaagaa
gagattgtaagcaagcacaaccaattgagacgaaaggtttctccatctggcagtgactta
ctaaatatggaatggaactatgatgctcaagtgaatgctcagcaacgggcagacaagtgt
acattcagtcacagtcctatagaactcaggacaactaatttaaaatgtggtgagaatttg
ttcatgtcatcttaccttgtaccatggtcttctgtaatccaaggatggtataatgaatcc
aaaggtcttatatttggtgtgggcccaaagcaaaatgttagtgtggttggacatcatact
caggttgtttggaaatcaaatttacaagttgcatgtggagttgctgaatgccctgaaaat
ccactgagatacttttatgtttgtcgctattgtcctgtattgaattacagtggccattat
ccaagcaggccatacctagcttacacagcaagagcaccatgtgccagttgtcctgatcgc
tgtgaagatggactgtgcaccaagagttgtcaatataaggatatgtctttttggtgtaaa
cgtctggaatacgtctgtaaacatccaggtcttaaaaaacgttgcctagctacatgccaa
tgttaa

DBGET integrated database retrieval system