KEGG   Mus musculus (mouse): 11572
Entry
11572             CDS       T01002                                 

Gene name
Crisp3, Aeg, Aeg2, CR, CRI, CRISP-3, CRS3, SGP, SGP28
Definition
(RefSeq) cysteine-rich secretory protein 3
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: CAP Crisp
Other DBs
NCBI-GeneID: 11572
NCBI-ProteinID: NP_033769
MGI: 102552
Ensembl: ENSMUSG00000025433
Vega: OTTMUSG00000028254
UniProt: Q03402
Position
17 B2; 17 19.45 cM
AA seq 241 aa
MALMLVLFFLAAVLPPSLLQDNSQENSLEKLSTSKKSVQEEIVSKHNQLRRKVSPSGSDL
LNMEWNYDAQVNAQQRADKCTFSHSPIELRTTNLKCGENLFMSSYLVPWSSVIQGWYNES
KGLIFGVGPKQNVSVVGHHTQVVWKSNLQVACGVAECPENPLRYFYVCRYCPVLNYSGHY
PSRPYLAYTARAPCASCPDRCEDGLCTKSCQYKDMSFWCKRLEYVCKHPGLKKRCLATCQ
C
NT seq 726 nt   +upstreamnt  +downstreamnt
atggcattaatgcttgtgctgttcttcctggctgctgtactgcccccatcccttcttcaa
gataactctcaggagaacagtcttgagaaactttcaaccagtaaaaaatcagtccaagaa
gagattgtaagcaagcacaaccaattgagacgaaaggtttctccatctggcagtgactta
ctaaatatggaatggaactatgatgctcaagtgaatgctcagcaacgggcagacaagtgt
acattcagtcacagtcctatagaactcaggacaactaatttaaaatgtggtgagaatttg
ttcatgtcatcttaccttgtaccatggtcttctgtaatccaaggatggtataatgaatcc
aaaggtcttatatttggtgtgggcccaaagcaaaatgttagtgtggttggacatcatact
caggttgtttggaaatcaaatttacaagttgcatgtggagttgctgaatgccctgaaaat
ccactgagatacttttatgtttgtcgctattgtcctgtattgaattacagtggccattat
ccaagcaggccatacctagcttacacagcaagagcaccatgtgccagttgtcctgatcgc
tgtgaagatggactgtgcaccaagagttgtcaatataaggatatgtctttttggtgtaaa
cgtctggaatacgtctgtaaacatccaggtcttaaaaaacgttgcctagctacatgccaa
tgttaa

DBGET integrated database retrieval system