KEGG   Mus musculus (mouse): 11593
Entry
11593             CDS       T01002                                 

Gene name
Aga, AW060726
Definition
(RefSeq) aspartylglucosaminidase
  KO
K01444  N4-(beta-N-acetylglucosaminyl)-L-asparaginase [EC:3.5.1.26]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00511  Other glycan degradation
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    11593 (Aga)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    11593 (Aga)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.26  N4-(beta-N-acetylglucosaminyl)-L-asparaginase
     11593 (Aga)
SSDB
Motif
Pfam: Asparaginase_2
Other DBs
NCBI-GeneID: 11593
NCBI-ProteinID: NP_001005847
MGI: 104873
Ensembl: ENSMUSG00000031521
Vega: OTTMUSG00000060612
UniProt: Q64191 A2RSS6
Position
8; 8 B1.3
AA seq 346 aa
MERKSNLSLLLLLLVLGMPLVRGSSPLPLVVNTWPFKNATEAAWWTLLSGGSALDAVENG
CAVCEKEQCDGTVGFGGSPDEGGETTLDAMIMDGTAMDVGAVGGLRRIKNAIGVARRVLE
HTTHTLLVGDSATKFAESMGFTNEDLSTKTSRDLHSDWLSRNCQPNYWRNVIPDPSKYCG
PYKPSGFLKQSISPHKEEVDIHSHDTIGMVVIHKTGHTAAGTSTNGIKFKIPGRVGDSPI
PGAGAYADDTAGAAAATGDGDTLLRFLPSYQAVEYMRGGDDPAIACQKVILRIQKYYPNF
FGAVICASVNGSYGAACNKLPTFTQFSFMVSNSLHNEPTEKKVDCI
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagcggaagtcgaatctgtctctgcttctcctactgctggtcctgggcatgcccctg
gtgcggggctccagccctctgcccctggtcgtcaacacttggccttttaagaatgccact
gaagcagcgtggtggacattgctatctggaggttctgccctggatgcagtggagaacggc
tgtgctgtgtgtgagaaggagcagtgtgatgggactgtaggctttggaggaagtcctgat
gaaggtggcgaaaccaccctggatgccatgataatggatggcactgccatggatgtggga
gcagtgggaggccttagaagaattaaaaacgcgattggcgtggcgcggagagtcctggag
cataccacacacacgcttttagtgggggactcagccaccaagtttgctgaaagtatgggg
tttactaatgaggacttgtctaccaaaacctcaagagatcttcattcagattggctttct
cgaaattgccagccaaattattggagaaatgttattccagatccctcaaaatactgtgga
ccctacaaaccatctggtttcttaaagcagagtatttctccccacaaagaagaagtggat
atccacagccatgatactattggcatggttgtaatccataagacgggacatactgctgct
ggcacatccacaaatggtataaaattcaaaatacctggtcgtgtaggggattcaccaatc
cctggagccggagcctatgctgatgacacggctggagcagctgcagccactggcgatggt
gacacactcctgcgctttctgccgagctaccaagctgtagaatatatgagaggaggagat
gacccagccatagcttgccaaaaagtgattttaagaattcagaaatactatccaaacttc
tttggagcggtcatatgtgccagtgtgaacggaagttatggtgctgcttgcaacaaactt
ccaacatttacacaatttagtttcatggtttctaattctttacacaatgagccaaccgaa
aaaaaagtagactgcatctaa

DBGET integrated database retrieval system