KEGG   Mus musculus (mouse): 11595
Entry
11595             CDS       T01002                                 

Gene name
Acan, Agc, Agc1, CSPCP, Cspg1, b2b183Clo, cmd
Definition
(RefSeq) aggrecan
  KO
K06792  aggrecan 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    11595 (Acan)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    11595 (Acan)
   04091 Lectins [BR:mmu04091]
    11595 (Acan)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   11595 (Acan)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   11595 (Acan)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   11595 (Acan)
SSDB
Motif
Pfam: Xlink Lectin_C V-set Sushi I-set ig Ig_3 DUF166
Other DBs
NCBI-GeneID: 11595
NCBI-ProteinID: NP_031450
MGI: 99602
Ensembl: ENSMUSG00000030607
Vega: OTTMUSG00000058542
UniProt: Q61282
Position
7 D2; 7 44.88 cM
AA seq 2132 aa
MTTLLLVFVTLRVIAAVISEEVPDHDNSLSVSIPQPSPLKVLLGSSLTIPCYFIDPMHPV
TTAPSTAPLTPRIKWSRVSKEKEVVLLVATEGQVRVNSIYQDKVSLPNYPAIPSDATLEI
QNLRSNDSGIYRCEVMHGIEDSEATLEVIVKGIVFHYRAISTRYTLDFDRAQRACLQNSA
IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE
TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQGGMDMCSAG
WLADRSVRYPISKARPNCGGNLLGVRTVYLHANQTGYPDPSSRYDAICYTGEDFVDIPEN
FFGVGGEDDITIQTVTWPDLELPLPRNVTEGEALGSVILTAKPIFDLSPTISEPGEALTL
APEVGSTAFPEAEERTGEATRPWGFPAEVTRGPDSATAFASEDLVVRVTISPGAAEVPGQ
PRLPGGVVFHYRPGSTRYSLTFEEAQQACMHTGAVIASPEQLQAAYEAGYEQCDAGWLQD
QTVRYPIVSPRTPCVGDKDSSPGVRTYGVRPSSETYDVYCYVDKLEGEVFFATRLEQFTF
QEARAFCAAQNATLASTGQLYAAWSQGLDKCYAGWLADGTLRYPIITPRPACGGDKPGVR
TVYLYPNQTGLPDPLSKHHAFCFRGVSVAPSPGEEGGSTPTSPSDIEDWIVTQVGPGVDA
VPLEPKTTEVPYFTTEPRKQTEWEPAYTPVGTSPQPGIPPTWLPTLPAAEEHTESPSASE
EPSASAVPSTSEEPYTSSFAVPSMTELPGSGEASGAPDLSGDFTGSGDASGRLDSSGQPS
GGIESGLPSGDLDSSGLSPTVSSGLPVESGSASGDGEVPWSHTPTVGRLPSGGESPEGSA
SASGTGDLSGLPSGGEITETSTSGAEETSGLPSGGDGLETSTSGVDDVSGIPTGREGLET
SASGVEDLSGLPSGEEGSETSTSGIEDISVLPTGGESLETSASGVGDLSGLPSGGESLET
SASGAEDVTQLPTERGGLETSASGVEDITVLPTGRESLETSASGVEDVSGLPSGREGLET
SASGIEDISVFPTEAEGLDTSASGGYVSGIPSGGDGTETSASGVEDVSGLPSGGEGLETS
ASGVEDLGPSTRDSLETSASGVDVTGFPSGRGDPETSVSGVGDDFSGLPSGKEGLETSAS
GAEDLSGLPSGKEDLVGSASGALDFGKLPPGTLGSGQTPEVNGFPSGFSGEYSGADIGSG
PSSGLPDFSGLPSGFPTVSLVDSTLVEVITATTSSELEGRGTIGISGSGEVSGLPLGELD
SSADISGLPSGTELSGQASGSPDSSGETSGFFDVSGQPFGSSGVSEETSGIPEISGQPSG
TPDTTATSGVTELNELSSGQPDVSGDGSGILFGSGQSSGITSVSGETSGISDLSGQPSGF
PVFSGTATRTPDLASGTISGSGESSGITFVDTSFVEVTPTTFREEEGLGSVELSGFPSGE
TELSGTSGTVDVSEQSSGAIDSSGLTSPTPEFSGLPSGVAEVSGEFSGVETGSSLPSGAF
DGSGLVSGFPTVSLVDRTLVESITQAPTAQEAGEGPSGILEFSGAHSGTPDISGELSGSL
DLSTLQSGQMETSTETPSSPYFSGDFSSTTDVSGESIAATTGSGESSGLPEVTLNTSELV
EGVTEPTVSQELGHGPSMTYTPRLFEASGDASASGDLGGAVTNFPGSGIEASVPEASSDL
SAYPEAGVGVSAAPEASSKLSEFPDLHGITSAFHETDLEMTTPSTEVNSNPWTFQEGTRE
GSAAPEVSGESSTTSDIDTGTSGVPSATPMASGDRTEISGEWSDHTSEVNVAISSTITES
EWAQPTRYPTETLQEIESPNPSYSGEETQTAETTMSLTDAPTLSSSEGSGETESTVADQE
QCEEGWTKFQGHCYRHFHDRETWVDAERRCREQQSHLSSIVTPEEQEFVNKNAQDYQWIG
LNDRTIEGDFRWSDGHSLQFEKWRPNQPDNFFATGEDCVVMIWHERGEWNDVPCNYQLPF
TCKKGTVACGDPPVVEHARTLGQKKDRYEISSLVRYQCTEGFVQRHVPTIRCQPSGHWEE
PRITCTDPNTYKHRLQKRSMRPTRRSRPSMAH
NT seq 6399 nt   +upstreamnt  +downstreamnt
atgaccactttactcttggtctttgtgactctgagggtcatcgctgcagtgatctcagaa
gaagttccagaccatgacaactcactgagcgtgagcatccctcaaccatccccattgaag
gtcctcctagggtcttccctcaccatcccctgctacttcatcgaccccatgcatcctgtg
accactgccccctccactgcccccctcaccccaagaatcaagtggagccgtgtttccaag
gaaaaggaggtggtactgctggtggccactgaaggacaggttcgagtcaacagcatctac
caagacaaggtgtcgctccccaactatccagccatccccagcgatgctaccttggagatc
cagaaccttcgctccaatgactctgggatctaccgctgtgaagtgatgcacggcatcgag
gacagcgaagccaccctggaggtcatagtgaaaggtattgtgttccactacagagctatt
tccacacgctacaccctggactttgatcgagcacagcgggcttgcctacagaacagcgcc
atcatcgccaccccagaacaactgcaggctgcctatgaggatggcttccaccagtgcgat
gcaggctggctggctgaccagacagtcagataccccatccacacgccccgggaaggttgc
tatggtgacaaggacgagttccctggagtgagaacctacggaatccgggacaccaatgag
acctatgatgtgtactgcttcgctgaggagatggagggtgaggtcttttatgcgacatcc
ccagagaaattcaccttccaggaggcagccaacgagtgccggaggctgggggcacgcttg
gccaccacaggccagctctacctggcctggcagggcggtatggacatgtgcagcgctggc
tggctggcggaccgcagcgtgcgctaccccatctccaaggctcggcccaactgcgggggc
aacctcctgggtgtaaggactgtctatctacacgccaaccagacaggctatcctgatccc
tcatcccgatatgacgccatctgttacacaggtgaagattttgtagacatcccagaaaac
ttcttcggggtgggtggtgaagacgacatcaccatccagacggtgacctggccagacctg
gagctgcccctgccccgtaatgtcacagagggagaggccctgggcagcgtgatccttaca
gcaaagcccatctttgacctgtcccccactatctcagagccgggggaggccctcacactt
gcccctgaagtggggagcacagccttcccagaggctgaggagagaactggagaagccacc
agaccctggggctttcctgcagaagtcacacgtgggccggactctgccactgccttcgcc
agtgaggacctggtagtgcgagtgaccatctctccaggtgcagctgaagtccctggtcag
ccccgcttgccagggggagttgtattccactatcgcccaggctccaccagatactctctg
acatttgaggaggcacagcaggcctgcatgcacaccggggccgtcattgcctctcctgag
cagctccaagctgcctatgaggcaggctatgagcagtgtgatgctggctggctgcaggac
cagaccgtcagataccccattgtgagcccacgaaccccatgtgtgggtgacaaagacagc
agcccaggagtcaggacctacggcgtgcgcccatcatcagaaacctatgatgtctactgc
tacgtggacaagcttgagggggaagtgttcttcgccacacgcctcgagcagttcaccttc
caggaagcgcgggccttctgtgcggctcaaaatgccaccctggcctccaccggccagctc
tatgctgcctggagccagggtctggacaagtgctatgctggctggctggcagatggcacc
ctccgataccccatcatcacccctcggcctgcctgtggtggggacaaacctggcgtgaga
actgtctacctctaccccaaccaaaccggcctccctgacccactgtcaaagcaccatgcc
ttctgcttccgaggtgtgtcagtggcgccctctccaggagaagaagggggtagtacaccc
acatcaccctctgacatagaggactggatcgtcactcaggtggggcctggtgtggatgct
gtccccttggagccaaagacaacagaagtgccatatttcaccactgagccaagaaaacag
actgaatgggagccagcctacaccccagtgggcacatccccacagccagggatccctccc
acatggcttcccaccctcccagcagcagaggaacacacagaaagcccctctgcctctgaa
gagccctctgcctcagcagtcccttccacctcagaggagccatacacatcttcatttgca
gtgccgagcatgacagagctgccaggctctggggaggcgtcgggcgcacctgacctcagt
ggtgacttcacaggcagtggagatgcttcaggacgccttgactccagtgggcagccttca
gggggcattgaaagtggccttccctcaggtgaccttgactccagtggcctcagccccaca
gtgagctcaggcctgcctgtagaaagtggttctgcctcaggagatggagaagtcccctgg
tcccatactcccacagttggcaggttgccctctggaggtgagagccccgaaggctctgcc
tctgcctctggaacaggagaccttagtgggctgccttcaggaggagaaattacagaaact
tctacttctggggcagaagaaaccagtggacttccttctggaggagacggtctagaaact
tctacctctggagtagatgatgtcagtggaattcctactggaagagaaggtctagagact
tctgcctctggagtagaggacctcagtggacttccttctggagaagaaggttcagaaaca
tctacctctggaatagaggacatcagtgtacttccaactggaggagaaagtctagaaacc
tctgcttctggagtgggagacttgagtggacttccctcaggaggagaaagtctagaaaca
tctgcttcaggtgcagaggatgtcactcagcttcctactgaaagaggaggtctagagact
tctgcctctggagtagaagacatcactgttcttcctactggaagagaaagtctagaaact
tctgcctctggagtagaggatgtcagtggacttccttctggaagagaaggtctagagact
tctgcctctggaatagaggacattagtgtgtttcctactgaagcagaaggtctggacact
tctgcctctgggggatatgttagtgggattccttctggaggagatggtacagaaacctct
gcttctggagtagaggatgtgagtggtcttccatctggaggagagggtctagaaacttct
gcctctggagtggaagatcttggtccttctactagagatagtctagagacatctgcttca
ggagtagatgttactgggtttccttctggaagaggggacccagagacctctgtttctggg
gtaggtgatgacttcagtggacttccttctggaaaagaaggcctggagacctcagcttct
ggagctgaggacctcagtggcttgccctctggaaaagaagacttggtagggtctgcttct
ggggccttggactttggcaaactacctcctggaactctaggaagtggtcaaactccagaa
gtaaatggctttccctctggatttagtggtgagtattctggagcagacattggaagtggc
ccatcctctggcctgcctgactttagtggacttccatctggctttccaactgtctccctt
gtggacagtaccttagtggaagtgatcacagccaccacttccagtgaactggaaggaagg
gggaccattggcatcagtggttcaggagaagtatcagggctgcccctgggtgaattggac
agtagtgcggacattagtggtctcccttcaggaactgaactcagtggccaagcatctgga
tctcctgatagcagtggagaaacatctggattttttgatgttagtggacagccatttggg
tcttctggcgtcagcgaggaaacatctgggattcctgaaatcagtgggcagccatcaggg
actcctgacaccactgcgacatctggagtgactgagcttaatgaactgtcctctggacaa
ccagatgtcagtggagatgggtctggaattctctttggcagtggacagtcctctggtata
acatctgtgagtggagaaacctctgggatttctgatctcagtgggcagccctcagggttc
ccagtgttcagtggaacagcaaccagaacccctgacctggcttctggcaccataagtggc
agtggagagtcttctggcattacatttgtggacaccagttttgttgaagtgacccctacc
acatttagggaagaagaagggttaggatctgtggaactcagtggctttccttctggggag
acggaactgtctggcacatctgggacggtggacgtcagtgaacaatcttctggagcaatt
gattccagtggactcacatcccccactccagagttcagtggcctcccaagtggagtagct
gaggtcagtggtgaattctctggagttgagactgggagcagcttgccctcaggagcattt
gatggcagtggacttgtctcaggtttccccactgtgtctcttgtagacagaactttggtg
gaatctataactcaggctcctactgctcaagaagctggagaaggaccttcgggcattttg
gaattcagtggtgcccattctgggacaccagacatatctggggagctttctgggtctctg
gacctaagcacattgcagtctgggcagatggaaaccagcacggagacaccaagctctcca
tattttagtggagacttttccagcaccactgatgtaagtggagaatccatagctgccaca
actggcagtggggaaagctctgggcttccggaagttactttaaacacctcagagttagtg
gagggtgtgactgaacccactgtttcccaggaacttggccatggtccttctatgacatac
actccccggctctttgaggccagtggggacgcctcagcatccggggaccttggtggcgct
gtaacaaacttcccagggtctgggatagaagcttcagtcccagaagccagcagtgacctg
tctgcttaccctgaggctggtgtgggagtgtctgctgcccctgaggccagcagtaaactg
tctgagttcccagatctgcatggaatcacttctgccttccatgaaacagatctggaaatg
acaaccccaagcacagaggtaaacagcaacccatggacctttcaggaaggcaccagggag
ggatcggccgctccggaagtgagtggagaatctagcactacctccgacatagacacaggc
acttcaggggtgccttctgccacacccatggcttctggagacaggactgaaatcagcgga
gaatggtctgatcacacctcagaggtgaatgttgccatcagcagcaccatcacagagtcc
gagtgggcccagcctacccggtaccctacagagacacttcaagaaatcgaatccccaaat
ccctcatactcaggagaggagacccagacagcagaaacaaccatgtccctgacagatgcc
cccaccctctcttcttcagaagggtcaggggagacggagtcaaccgttgcagaccaggag
caatgtgaggaggggtggactaagttccagggtcactgttaccgccactttcatgaccga
gagacctgggtggatgcggagagacggtgtcgggagcagcagtcacatctgagcagcatt
gtcactcctgaggaacaggagttcgtcaacaaaaatgctcaagactaccagtggatcggt
ctgaatgacaggactatcgaaggggacttccgctggtctgacggacactctctgcaattt
gagaagtggcgtccaaaccagcctgacaacttctttgccaccggagaggactgtgtggtg
atgatctggcatgagagaggcgaatggaacgacgtcccctgcaattaccagctgcccttc
acgtgtaaaaagggcaccgtggcctgtggagaccccccagtggtggagcatgctagaacc
ctcgggcagaagaaagatcgctacgagatcagctccctggtgcggtaccagtgcactgag
ggctttgtccagcgccacgtgcccaccatccggtgccagcccagcgggcactgggaagag
cctcgaatcacctgcacagaccccaacacctacaagcacaggctacagaagcggagcatg
agacccacacggaggagccgccccagcatggcccactga

DBGET integrated database retrieval system